BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0742 (694 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 28 1.1 SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharo... 26 4.5 SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces... 26 5.9 >SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 28.3 bits (60), Expect = 1.1 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 Query: 191 NEQTHQRD*DYYLLF*IVK*NKLFCT*SLVIKFCAILGNFRFLSWI 328 NE HQRD Y + + + +L CT +V FC L L +I Sbjct: 312 NEHEHQRDPAYAIRTALTRGVRLLCTEPIVQAFCMYLVFINILLYI 357 >SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 2244 Score = 26.2 bits (55), Expect = 4.5 Identities = 9/41 (21%), Positives = 25/41 (60%) Frame = -3 Query: 194 HLSSDIQIYL*SLNLAFSVAHPVQVYLNVRQLVKVCFSKYI 72 H+ S Q+ L++ F++AH +++ + + ++ +C+ K + Sbjct: 1938 HIISVHQVTRSDLHVLFAIAHQMRIIVERQGVIDLCYGKLL 1978 >SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 857 Score = 25.8 bits (54), Expect = 5.9 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 4/62 (6%) Frame = +1 Query: 493 IKLPSEKCMKNASRTFENI----FNTSIKLEQNISQISLLKHNNKFIKIGLSSQLINNGT 660 + PS ++ F +I NTSIK +NIS ++ + +K I+ ++ +IN+ Sbjct: 158 VSFPSSSTPPSSDSNFSSIQNTDLNTSIKFTENISANAIHVNQDKVIR-SANNLIINSQP 216 Query: 661 II 666 I+ Sbjct: 217 IL 218 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,754,217 Number of Sequences: 5004 Number of extensions: 56450 Number of successful extensions: 120 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -