BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0742 (694 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0269 - 16617292-16618852,16622763-16623562 29 4.6 03_02_0849 - 11768191-11771412 28 6.1 >12_02_0269 - 16617292-16618852,16622763-16623562 Length = 786 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -2 Query: 426 NSQEDSKTSFMFDS*YRQTNELNACNIFTLNFNIQLRNRKLP 301 N ++D F + EL +CN+ L+FN+ L + P Sbjct: 712 NDEDDQTDMVKFAALATSLRELGSCNVRCLDFNVALMEHRQP 753 >03_02_0849 - 11768191-11771412 Length = 1073 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 34 RKIQNIQLIYEHVMYLLKQTFTSC 105 R + ++Q+ Y H+ Y LKQ FT C Sbjct: 411 RILPSLQISYHHLPYHLKQLFTLC 434 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,667,658 Number of Sequences: 37544 Number of extensions: 261716 Number of successful extensions: 400 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 400 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -