BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0736 (617 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.09 |mug161||CwfJ family protein|Schizosaccharomyces pomb... 27 2.2 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 27 2.2 >SPAC1F3.09 |mug161||CwfJ family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 27.1 bits (57), Expect = 2.2 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 196 PIYYPT--YKNISYLFTNFVSVTFRLRLCGVKNSKN 297 P+YY YKN + + N +VT + L KNSKN Sbjct: 204 PVYYEREPYKNSAAINVNTGTVTHFVALAPFKNSKN 239 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 27.1 bits (57), Expect = 2.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 191 AFQYIIQRIKIYHIYSQISSQLRSGLDCAVSKIQKT 298 AF Y+ K+Y S ++ L S + C KI K+ Sbjct: 926 AFTYVCNISKLYVYKSDATNSLASSIRCTADKISKS 961 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,509,845 Number of Sequences: 5004 Number of extensions: 49508 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -