BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0735 (412 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 24 0.50 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 24 0.50 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 24 0.50 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 24 0.50 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 24 0.50 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 0.50 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 24 0.50 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 24 0.50 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 24 0.67 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 1.5 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 1.5 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 2.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 2.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 2.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 2.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 2.7 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 3.6 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 6.2 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 20 8.2 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 202 ATSGIGVTNTTDAKTEPPSKPS 267 AT G+T+ T PP KP+ Sbjct: 137 ATKSSGLTSPLSVSTSPPGKPA 158 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 202 ATSGIGVTNTTDAKTEPPSKPS 267 AT G+T+ T PP KP+ Sbjct: 137 ATKSSGLTSPLSVSTSPPGKPA 158 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 202 ATSGIGVTNTTDAKTEPPSKPS 267 AT G+T+ T PP KP+ Sbjct: 137 ATKSSGLTSPLSVSTSPPGKPA 158 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 202 ATSGIGVTNTTDAKTEPPSKPS 267 AT G+T+ T PP KP+ Sbjct: 137 ATKSSGLTSPLSVSTSPPGKPA 158 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 202 ATSGIGVTNTTDAKTEPPSKPS 267 AT G+T+ T PP KP+ Sbjct: 137 ATKSSGLTSPLSVSTSPPGKPA 158 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 202 ATSGIGVTNTTDAKTEPPSKPS 267 AT G+T+ T PP KP+ Sbjct: 93 ATKSSGLTSPLSVSTSPPGKPA 114 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 202 ATSGIGVTNTTDAKTEPPSKPS 267 AT G+T+ T PP KP+ Sbjct: 137 ATKSSGLTSPLSVSTSPPGKPA 158 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 0.50 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 202 ATSGIGVTNTTDAKTEPPSKPS 267 AT G+T+ T PP KP+ Sbjct: 137 ATKSSGLTSPLSVSTSPPGKPA 158 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.8 bits (49), Expect = 0.67 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 202 ATSGIGVTNTTDAKTEPPSKP 264 AT G+T+ T PP KP Sbjct: 137 ATKSSGLTSPLSVSTSPPGKP 157 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 294 QLLLKSHLAAWFAWWLSFSICSIRHTNTTCSRC 196 Q+ + L W+SF + + H N T RC Sbjct: 131 QIFITCELFFVILLWISFFLNFMLHCNNTTWRC 163 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 237 ICSIRHTNTTCSRCNSSKPEA 175 I S +TNT+ S NS+KP + Sbjct: 423 ITSPSNTNTSTSSTNSNKPNS 443 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 2.7 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +3 Query: 219 CDEYYRC 239 CD+YYRC Sbjct: 488 CDKYYRC 494 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 2.7 Identities = 10/42 (23%), Positives = 17/42 (40%) Frame = -2 Query: 324 FVS*QIL*MNQLLLKSHLAAWFAWWLSFSICSIRHTNTTCSR 199 F S ++ +N + H W W LS + ++ C R Sbjct: 447 FESPPVVFLNDFISHQHAWIWLLWLLSQTWITLHIWTPKCER 488 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 2.7 Identities = 10/42 (23%), Positives = 17/42 (40%) Frame = -2 Query: 324 FVS*QIL*MNQLLLKSHLAAWFAWWLSFSICSIRHTNTTCSR 199 F S ++ +N + H W W LS + ++ C R Sbjct: 447 FESPPVVFLNDFISHQHAWIWLLWLLSQTWITLHIWTPKCER 488 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 2.7 Identities = 10/42 (23%), Positives = 17/42 (40%) Frame = -2 Query: 324 FVS*QIL*MNQLLLKSHLAAWFAWWLSFSICSIRHTNTTCSR 199 F S ++ +N + H W W LS + ++ C R Sbjct: 447 FESPPVVFLNDFISHQHAWIWLLWLLSQTWITLHIWTPKCER 488 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 2.7 Identities = 10/42 (23%), Positives = 17/42 (40%) Frame = -2 Query: 324 FVS*QIL*MNQLLLKSHLAAWFAWWLSFSICSIRHTNTTCSR 199 F S ++ +N + H W W LS + ++ C R Sbjct: 447 FESPPVVFLNDFISHQHAWIWLLWLLSQTWITLHIWTPKCER 488 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 3.6 Identities = 5/6 (83%), Positives = 6/6 (100%) Frame = +3 Query: 81 HWHGHY 98 HWHGH+ Sbjct: 134 HWHGHH 139 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 20.6 bits (41), Expect = 6.2 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +3 Query: 12 YWVGSEFWSWYSNYSNRVWT 71 +W +E+ +W Y+N++ T Sbjct: 493 FWGTTEYHNWRVVYNNKIPT 512 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 20.2 bits (40), Expect = 8.2 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 216 NTTCSRCNSSKPEA*C 169 N +RCN +P+A C Sbjct: 454 NPLDARCNEIRPDAIC 469 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,958 Number of Sequences: 336 Number of extensions: 1652 Number of successful extensions: 21 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8963165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -