BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0734 (672 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 27 0.11 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 6.9 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 27.5 bits (58), Expect = 0.11 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 287 IFVIVLSMYCKILITMSTIYVYVKFIL 207 IF I L YC ++I + Y Y FIL Sbjct: 221 IFTIHLLFYCVLIILLCIYYFYYAFIL 247 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 544 LINISAIIMILWFFLCN*LIYCCF 473 L+ I ++ L+F LC YC F Sbjct: 130 LLCIYYFVVPLFFLLCIYYFYCAF 153 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.4 bits (43), Expect = 6.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +3 Query: 180 LNLIDTLFH*NELNVDVNCAHCDENFTIHTQHNHENLLIYLNFPFHSYYLF 332 L+++ +H ++NV + + F H +N +IY N F LF Sbjct: 111 LHVVKQCYHLQKINVQQSGIFINLPFLEHNLIRLKNCVIYFNRIFGWNILF 161 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,884 Number of Sequences: 336 Number of extensions: 3060 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -