BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0734 (672 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC132.04c |||NAD-dependent glutamate dehydrogenase |Schizosacc... 26 4.3 SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces ... 26 4.3 SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosacc... 26 5.7 >SPCC132.04c |||NAD-dependent glutamate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 1106 Score = 26.2 bits (55), Expect = 4.3 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 222 VDVNCAHCDENFTIHTQHNHENLLIYLN 305 + + +H E IH ++ +E+L IYL+ Sbjct: 162 IAAHASHAKEELNIHVKNENEDLAIYLD 189 >SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1888 Score = 26.2 bits (55), Expect = 4.3 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +2 Query: 425 SLHYFKSITNSLLMAFEATVNQLVTQEKPQNHYYCRYIYQLFSFKLFS 568 S++YFKS+ +LL A + +L K +Y+ LF L S Sbjct: 1455 SINYFKSVHLNLLTAVFCNMAKLYADAKTNGFASSQYLQSLFIHYLSS 1502 >SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 25.8 bits (54), Expect = 5.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +3 Query: 273 HNHENLLIYLNFPFHSYYLF*IRAIMERNRSMPPMNTN 386 +++ N + YLN P + YLF +++ N + +N N Sbjct: 1119 NSNRNNVFYLNIPGNECYLFEAPSVLAMNEWIHSLNFN 1156 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,453,131 Number of Sequences: 5004 Number of extensions: 46419 Number of successful extensions: 112 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -