Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0734
         (672 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g02250.1 68416.m00206 expressed protein contains Pfam PF03138...    28   6.5  

>At3g02250.1 68416.m00206 expressed protein contains Pfam PF03138:
           Plant protein family. The function of this family of
           plant proteins is unknown; previously annotated as
           'auxin-independent growth promoter -related'  based on
           similarity to axi 1 protein (GB:X80301) (GI:559920) from
           [Nicotiana tabacum], which, due to scienitific fraud was
           retracted. Retraction in: Schell J. EMBO J 1999 May
           17;18(10):2908. PMID:10400497.
          Length = 512

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 16/38 (42%), Positives = 19/38 (50%)
 Frame = +3

Query: 144 LFSLVKIYKRN*LNLIDTLFH*NELNVDVNCAHCDENF 257
           +  LVK YK   LN  DT    NEL V++    C  NF
Sbjct: 210 ILPLVKKYKVVHLNKTDTRLANNELPVEIQKLRCRANF 247


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,852,510
Number of Sequences: 28952
Number of extensions: 207510
Number of successful extensions: 374
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 366
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 374
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1422784080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)