BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0733 (694 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54060.1 68416.m05977 hypothetical protein mucin MUC3, Homo s... 31 0.55 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 30 1.3 At4g32790.1 68417.m04665 exostosin family protein contains Pfam ... 30 1.7 At3g48060.1 68416.m05240 bromo-adjacent homology (BAH) domain-co... 30 1.7 At1g25886.1 68414.m03180 Ulp1 protease family protein contains P... 30 1.7 At5g18570.1 68418.m02195 GTP1/OBG family protein similar to SP|P... 29 2.9 At4g09060.1 68417.m01493 expressed protein 29 2.9 At4g11670.1 68417.m01865 expressed protein contains Pfam PF05664... 29 3.9 At1g74160.1 68414.m08589 expressed protein 29 3.9 At5g47070.1 68418.m05800 protein kinase, putative similar to pro... 28 5.1 At5g44970.1 68418.m05515 hypothetical protein contains a novel d... 28 5.1 At5g24220.1 68418.m02850 lipase class 3-related 28 5.1 At4g19510.2 68417.m02870 disease resistance protein (TIR-NBS-LRR... 28 5.1 At4g19510.1 68417.m02869 disease resistance protein (TIR-NBS-LRR... 28 5.1 At2g35670.1 68415.m04375 transcription factor, putative / fertil... 28 5.1 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 28 6.8 At4g08880.1 68417.m01464 Ulp1 protease family protein contains P... 28 6.8 At3g18890.1 68416.m02399 expressed protein similar to UV-B and o... 28 6.8 At2g12900.1 68415.m01408 hypothetical protein similar to transcr... 28 6.8 At1g51140.1 68414.m05749 basic helix-loop-helix (bHLH) family pr... 28 6.8 At1g17580.1 68414.m02165 myosin, putative similar to myosin GI:4... 28 6.8 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 27 8.9 At1g51170.1 68414.m05754 protein kinase family protein 27 8.9 At1g41860.1 68414.m04834 hypothetical protein 27 8.9 >At3g54060.1 68416.m05977 hypothetical protein mucin MUC3, Homo sapiens, EMBL:AF007193 Length = 456 Score = 31.5 bits (68), Expect = 0.55 Identities = 20/87 (22%), Positives = 42/87 (48%) Frame = +1 Query: 280 RPKSWPLEAQDPLRHTKLYTQLTN*LQTYFTSDRKIKVTRDQKLTSKNHDKLTKIPEINS 459 R ++ L + P+R+ + + ++ S +K KV+ DQ+ + +K+ ++ + Sbjct: 44 RSEASSLISDSPIRNVPNSLMTLDAMLNHYVSLKKQKVSLDQEKLKLDQEKI-RVQNLLQ 102 Query: 460 HSENFTRNTKNQTYASPPKVRSPLSYE 540 EN NT N + +PP +P S + Sbjct: 103 GMEN-VMNTYNASLTAPPPASAPTSQQ 128 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 30.3 bits (65), Expect = 1.3 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = +2 Query: 281 DQSPGPSKRRILSDIQNSILSSPINYKPTSPLIERLKSPETRNSPLKTMTNSPKSQR-LT 457 ++SP P + + + S+P KP SP E K+ + + P SPK + Sbjct: 438 EESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKPKPESPKQESPKQEAPKP 497 Query: 458 LTPKTSQETPKIRHTPVHP 514 PK E+PK + P Sbjct: 498 EQPKPKPESPKQESSKQEP 516 >At4g32790.1 68417.m04665 exostosin family protein contains Pfam domain, PF03016: Exostosin family Length = 593 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 295 PLEAQDPLRHTKLYTQLTN*LQTYFTSDRKIKV 393 PL DPL HT LY L+ ++Y ++K+KV Sbjct: 237 PLIENDPLLHTPLYWNLSMFKRSYELMEKKLKV 269 >At3g48060.1 68416.m05240 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 1611 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/59 (25%), Positives = 31/59 (52%) Frame = +1 Query: 475 TRNTKNQTYASPPKVRSPLSYEIAENILDRPSPLTSRSLRGTLKIKEVLEDRSWYKRSN 651 T + N+ P+ RSP + ++ L+ P+P+ SR +K+ L D +W ++++ Sbjct: 614 TEGSGNKLIVKLPRGRSP-AQSVSGGSLEDPAPVNSRVSSPVHTVKQELCDNNWREKNH 671 >At1g25886.1 68414.m03180 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At4g03300 Length = 1201 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 394 TRDQKLTSKNHDKLTKIPEINSHSENFTR-NTKNQTYASPPKVRSPLSYEI 543 T D S DK T IP+ N S+N K + +SP KV+ L YE+ Sbjct: 818 TEDPNPGSDEADK-TDIPKNNDESDNAAAVEAKEEKKSSPKKVKKQLVYEL 867 >At5g18570.1 68418.m02195 GTP1/OBG family protein similar to SP|P20964 Spo0B-associated GTP-binding protein {Bacillus subtilis}; contains Pfam profile PF01018: GTP1/OBG family Length = 681 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 373 SDRKIKVTRDQKLTSKNHDKLTKIPEINSHSENFTRNTKNQTY 501 S RK K+ R+ +L S+ DKL + + + +TR + Y Sbjct: 37 SPRKTKLQREVELKSRGGDKLQPVSDAGGEATTYTRLPPREDY 79 >At4g09060.1 68417.m01493 expressed protein Length = 341 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +2 Query: 305 RRILSDIQNSILSSPINYKPTSPLIERLKSPETRNSPLKTMT--NSPKSQRLTLTP 466 R++L Q+ + S+ N S + KSP+T +SP++ +SP+ R L+P Sbjct: 273 RKLLRQQQSPLCSADKNRNSASAKSNKRKSPKTMSSPVEKRLEFSSPEISRKPLSP 328 >At4g11670.1 68417.m01865 expressed protein contains Pfam PF05664: Protein of unknown function (DUF810) Length = 985 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 343 LTN*LQTYFTSDRKIKVTRDQKLTSKNHDKLTKIPEI-NSHSE 468 LTN ++ Y T RKI+ + L+ K DK P+I N+HSE Sbjct: 189 LTNSVEAYPTHRRKIEKSSRLMLSLKRKDKPHLQPQISNTHSE 231 >At1g74160.1 68414.m08589 expressed protein Length = 1030 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +2 Query: 299 SKRRILSDIQNSILSSPINYKPTSPLIERLKSPETRNSPLKTMTNSPKSQR 451 S+ R+ S N + SPI + L+E+ P + P+ ++T K +R Sbjct: 472 SRTRVQSSSSNQVYQSPIVIMKPAKLVEKAGIPASSLIPIHSLTGIKKIRR 522 >At5g47070.1 68418.m05800 protein kinase, putative similar to protein kinase [Lophopyrum elongatum] gi|13022177|gb|AAK11674 Length = 410 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 201 NNATKRKQEEAFSHNYKKRCTPTRLASTKVLAPRSAGSSQTYKTLYSAHQ 350 NN KRK +E ++ + + +S + PRS S ++ K LY+ + Sbjct: 19 NNKNKRKGKELLQNSAPELTNRSETSSFNLQTPRSLPSPRSIKDLYTERE 68 >At5g44970.1 68418.m05515 hypothetical protein contains a novel domain with similarity to F-box domain; Length = 389 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 368 SPLIERLKSPETRNSPLKTMTNSP 439 SP++++LK P +SP+ TMTN P Sbjct: 344 SPILKKLK-PSFTDSPMSTMTNLP 366 >At5g24220.1 68418.m02850 lipase class 3-related Length = 376 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 14 FIPFILVDN*TILDCYDNGLVILVF*IRIKTLCQN 118 F F LV+ T++D YD+ + VF ++ LCQN Sbjct: 79 FFNFSLVE--TLIDDYDSSIYGAVFEYKLSNLCQN 111 >At4g19510.2 68417.m02870 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1049 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 364 YFTSDRKIKVTRDQKLTSKNHDKLTKIPEIN 456 Y R + +TRD+KL KN D +P +N Sbjct: 317 YRQGSRIVIITRDKKLLQKNADATYVVPRLN 347 >At4g19510.1 68417.m02869 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1049 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 364 YFTSDRKIKVTRDQKLTSKNHDKLTKIPEIN 456 Y R + +TRD+KL KN D +P +N Sbjct: 317 YRQGSRIVIITRDKKLLQKNADATYVVPRLN 347 >At2g35670.1 68415.m04375 transcription factor, putative / fertilization-independent seed 2 protein (FIS2) identical to GB:AF096095 Length = 632 Score = 28.3 bits (60), Expect = 5.1 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 1/92 (1%) Frame = +1 Query: 412 TSKNHDKLTKIPEINSHSENFTRNTKNQTYASPPKVRSPLSYEIAENILDRPSPLTSRSL 591 T N D ++ P+ +S +N + + ++ + PP+ RS S E ++ IL P Sbjct: 206 THVNEDNISSPPKAHSSKKNESTHMNDEDVSFPPRTRS--SKETSD-ILTTTQPAIVEP- 261 Query: 592 RGTLKIKEVLEDRSWY-KRSNKENCEPMMAET 684 K++ V + Y KR +P +AE+ Sbjct: 262 -SEPKVRRVSRRKQLYAKRYKARETQPAIAES 292 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +2 Query: 341 SSPINYKPTSPLIERLKSPETRNSPLKTMTNSPKSQRLTLTPKTSQETP 487 SSP P +P +SP +SP + +P Q L P S+ TP Sbjct: 283 SSPAQ-SPATPSPMTPQSPSPVSSPSPDQSAAPSDQSTPLAPSPSETTP 330 >At4g08880.1 68417.m01464 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1463 Score = 27.9 bits (59), Expect = 6.8 Identities = 23/89 (25%), Positives = 35/89 (39%), Gaps = 1/89 (1%) Frame = +1 Query: 394 TRDQKLTSKNHDKLTKIPEINSHSENFTRNTKNQTYASPPKVRSPL-SYEIAENILDRPS 570 T D S DK T IP+ N S+N T + S PK + + ++ N LD Sbjct: 712 TEDPNPGSDEADK-TDIPKNNDESDNATAVEAKEEKKSSPKTEVVIRAGNVSYNPLDMVD 770 Query: 571 PLTSRSLRGTLKIKEVLEDRSWYKRSNKE 657 PL +K V+ +++ E Sbjct: 771 PLKVEEFSNIIKGPSVIHTLFGFRKVPNE 799 >At3g18890.1 68416.m02399 expressed protein similar to UV-B and ozone similarly regulated protein 1 UOS1 [Pisum sativum] GI:20339364 Length = 641 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/71 (25%), Positives = 32/71 (45%) Frame = +2 Query: 296 PSKRRILSDIQNSILSSPINYKPTSPLIERLKSPETRNSPLKTMTNSPKSQRLTLTPKTS 475 PSKR + + S+ + + PT P+ + +P+ +P K P+ L+P S Sbjct: 327 PSKRPYVPPPKASVATKEVKPVPTKPVTQEPTAPKEDEAPPKEKNVKPR----PLSPYAS 382 Query: 476 QETPKIRHTPV 508 E K +P+ Sbjct: 383 YEDLKPPTSPI 393 >At2g12900.1 68415.m01408 hypothetical protein similar to transcription factor(bZIP family) VSF-1 GI:3425907 from [Lycopersicon esculentum] Length = 264 Score = 27.9 bits (59), Expect = 6.8 Identities = 28/97 (28%), Positives = 46/97 (47%) Frame = +1 Query: 367 FTSDRKIKVTRDQKLTSKNHDKLTKIPEINSHSENFTRNTKNQTYASPPKVRSPLSYEIA 546 +T D K+ + KL ++ K TK+ EI S + R KN+ A+ K R L Y I Sbjct: 87 YTDDELNKIAKSTKL--QDIAKSTKLQEIVSDPKKVRRILKNRELAASSKQRK-LKYMI- 142 Query: 547 ENILDRPSPLTSRSLRGTLKIKEVLEDRSWYKRSNKE 657 ++ R L +++ KIK + +D++ KE Sbjct: 143 -DLEHRIKFLENKNALIFEKIKLLEKDKTILMNEKKE 178 >At1g51140.1 68414.m05749 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 379 Score = 27.9 bits (59), Expect = 6.8 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +1 Query: 451 INSHSENFTRNTKNQTYASPPKVRSPLSYEIAENILDRP-SPLTSRSLRGTLKIKEVLED 627 ++ H RN+ Y S P E E LDRP SP T R L G L+ + ++ Sbjct: 12 LHDHQHQRPRNSGLIRYQSAPSSYFSSFGESIEEFLDRPTSPETERILSGFLQTTDTSDN 71 >At1g17580.1 68414.m02165 myosin, putative similar to myosin GI:433663 from (Arabidopsis thaliana) Length = 1520 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = +2 Query: 380 ERLKSPETRNSPLK--TMTNSPKSQRLTLTPKTS--QETPK 490 E++ S E+ N L+ T+T SP ++ L L PKT+ Q TP+ Sbjct: 1032 EKVFSLESENKVLRQQTLTISPTTRALALRPKTTIIQRTPE 1072 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 27.5 bits (58), Expect = 8.9 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +2 Query: 308 RILSDIQNSILSSPINYKPTSPLIERLKSPETRNSPLKTMTNSPKSQRLTLTPKTSQETP 487 + L Q S+L SP P SP +SP ++SP ++ +P S L TP + P Sbjct: 213 KCLLRFQTSVLLSP----PPSPSAPPPRSPPPKSSPPSSLPQTP-SPPLVFTPPQNVPNP 267 >At1g51170.1 68414.m05754 protein kinase family protein Length = 404 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 338 LSSPINYKPTSPLIERLKSPETRNSPLKTMTNSPKSQRLTLTPKTSQETPKI 493 LS +N KPT P L PE +P ++++ KS R+ K ++ ++ Sbjct: 174 LSCSLN-KPTRPEFYHLSDPEPDPNPESNLSHNKKSLRIFRQKKKKTKSARV 224 >At1g41860.1 68414.m04834 hypothetical protein Length = 178 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +1 Query: 415 SKNHDKLTKIPEINSHSENFTRNTKNQTYASPPKVRSPLSYE-IAENILDRPSPL 576 +K+ + K+ NFTR N +Y +PP + + E + E IL S L Sbjct: 51 TKSKELRNKLTAFTQGRNNFTRTYGNSSYQTPPPLTAESKIESMLEQILKGQSKL 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,722,813 Number of Sequences: 28952 Number of extensions: 309456 Number of successful extensions: 1086 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1086 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -