BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0730 (473 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 23 1.3 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 3.8 AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. 21 6.7 AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. 21 6.7 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 23.4 bits (48), Expect = 1.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 Query: 201 WRYGAYLYRQPVA*PPFWHD 142 W G LY V PPFW + Sbjct: 96 WACGVILYILLVGYPPFWDE 115 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 403 SHDVVKRRPVNCNTTHYRANWVPGP 329 S + K++P +C+T YR V P Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584 >AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.0 bits (42), Expect = 6.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 149 GMMLGQGMDVQSAQEKIGQVVEGYRNTKEV 60 G+M + + +K GQ E ++N KEV Sbjct: 104 GLMEASLIGLVERHKKRGQTKEEFQNLKEV 133 >AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.0 bits (42), Expect = 6.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 149 GMMLGQGMDVQSAQEKIGQVVEGYRNTKEV 60 G+M + + +K GQ E ++N KEV Sbjct: 104 GLMEASLIGLVERHKKRGQTKEEFQNLKEV 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,745 Number of Sequences: 438 Number of extensions: 3949 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12805416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -