BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0724 (599 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17169| Best HMM Match : Pep_M12B_propep (HMM E-Value=1.5e-06) 28 5.0 SB_44986| Best HMM Match : Ion_trans_2 (HMM E-Value=6.9e-15) 27 8.8 >SB_17169| Best HMM Match : Pep_M12B_propep (HMM E-Value=1.5e-06) Length = 337 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 172 IPPHLLRQYLADQGGAQPHTISR 240 +P HL + Y D GGAQPH I R Sbjct: 223 LPDHLAKYYGKD-GGAQPHLIHR 244 >SB_44986| Best HMM Match : Ion_trans_2 (HMM E-Value=6.9e-15) Length = 711 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 26 FFKNKYFQVVNCFVCASCCVSALRWQYWGAFWRR 127 FFK K F++V A V L W FWRR Sbjct: 505 FFKEKTFEIVTYSGMAVVGVFILTGVVWEYFWRR 538 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,603,076 Number of Sequences: 59808 Number of extensions: 234386 Number of successful extensions: 481 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -