BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0724 (599 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.3 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 9.2 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 9.2 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 21 9.2 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -1 Query: 212 PWSARYCL 189 PW+ RYCL Sbjct: 142 PWNTRYCL 149 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -1 Query: 212 PWSARYCL 189 PW+ RYCL Sbjct: 195 PWNTRYCL 202 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 496 SFLFW*LVYWSSF 458 SFL +VYWS+F Sbjct: 370 SFLILNVVYWSTF 382 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +2 Query: 131 NINTKRSHNNTEKVSLLIY*GNILLTKEALSPIP 232 N N K ++NN L Y I+ ++ P+P Sbjct: 99 NYNNKYNYNNNNYNKKLYYKNYIINIEQIPVPVP 132 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 113 HPSIANVTHLRNMMHTQN 60 HP A VTHL + ++N Sbjct: 105 HPHTAMVTHLPQTLTSEN 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,164 Number of Sequences: 438 Number of extensions: 2388 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -