SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0724
         (599 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    22   5.3  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    22   5.3  
DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    21   9.2  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    21   9.2  
AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.          21   9.2  

>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -1

Query: 212 PWSARYCL 189
           PW+ RYCL
Sbjct: 142 PWNTRYCL 149


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -1

Query: 212 PWSARYCL 189
           PW+ RYCL
Sbjct: 195 PWNTRYCL 202


>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -2

Query: 496 SFLFW*LVYWSSF 458
           SFL   +VYWS+F
Sbjct: 370 SFLILNVVYWSTF 382


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 10/34 (29%), Positives = 16/34 (47%)
 Frame = +2

Query: 131 NINTKRSHNNTEKVSLLIY*GNILLTKEALSPIP 232
           N N K ++NN      L Y   I+  ++   P+P
Sbjct: 99  NYNNKYNYNNNNYNKKLYYKNYIINIEQIPVPVP 132


>AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.
          Length = 147

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = -1

Query: 113 HPSIANVTHLRNMMHTQN 60
           HP  A VTHL   + ++N
Sbjct: 105 HPHTAMVTHLPQTLTSEN 122


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,164
Number of Sequences: 438
Number of extensions: 2388
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17604432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -