BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0723 (655 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19G12.02c |pms1||MutL family mismatch-repair protein Pms1|Sc... 27 1.8 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 25 9.5 SPAC1952.17c ||SPAC890.01c|GTPase activating protein|Schizosacch... 25 9.5 SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccha... 25 9.5 >SPAC19G12.02c |pms1||MutL family mismatch-repair protein Pms1|Schizosaccharomyces pombe|chr 1|||Manual Length = 794 Score = 27.5 bits (58), Expect = 1.8 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +2 Query: 386 SVANTDPSKSSASQNLP--QDRKRDSLRKSGEKLS 484 SVAN PSK++A Q L Q R D L K +K++ Sbjct: 527 SVANRIPSKTAALQKLKFFQSRPLDGLNKFSKKIN 561 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 25.0 bits (52), Expect = 9.5 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -2 Query: 636 TYHFVWYLGLLFKLQKISLVDSFARDCKNILRKLLRMI*SL 514 TYHF+ L + ++Q I +D FA +N + LL + +L Sbjct: 166 TYHFLSLLNVQLRIQPIWWMDEFAE--RNGIESLLSALRNL 204 >SPAC1952.17c ||SPAC890.01c|GTPase activating protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 619 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +2 Query: 383 RSVANTDPSKSSASQNLPQDRKRDSLRKSGEKLS 484 +S N PS ++ S+N+ + + D + + G+KL+ Sbjct: 136 KSEINKKPSVNNVSENISVNTEDDKVEEVGQKLN 169 >SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.0 bits (52), Expect = 9.5 Identities = 15/59 (25%), Positives = 26/59 (44%) Frame = +3 Query: 69 FNRNTTNRYHGNEYCQNNKMSDARTQLYASYYINSKPRVNILEKNNHIKKESCANPNSH 245 FN T GNE NN ++ Q YA+ +N+ R+ ++ + +P S+ Sbjct: 533 FNPRVTRFNVGNEQFSNNIDNNNYNQPYANATMNNSRRLRTPSGERSMRADLSQSPASY 591 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,504,665 Number of Sequences: 5004 Number of extensions: 48390 Number of successful extensions: 112 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -