BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0672 (571 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC343.20 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 27 2.6 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 25 5.9 >SPAC343.20 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 26.6 bits (56), Expect = 2.6 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 278 RFSFYFFITMF*LLLTKLIYTFILL*KTDNVTGKK*QIN 162 +F +Y IT+ LLTKLIY L ++ K+ +IN Sbjct: 65 KFVYYLAITLHTSLLTKLIYCHADLYALQSIKYKRLRIN 103 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 25.4 bits (53), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 323 IISIFLINTIKRAWFRFSFYFFITMF*LLLTKLIY 219 +I + L T+ W YF++TMF L++ IY Sbjct: 1426 LIMMLLFGTMT-VWTTHYVYFWVTMFALVICPFIY 1459 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,916,119 Number of Sequences: 5004 Number of extensions: 31549 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 242064240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -