BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0672 (571 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6273| Best HMM Match : MAM (HMM E-Value=0) 28 4.7 SB_4958| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 28.3 bits (60), Expect = 4.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 345 FLCVNIWYHQYFSH 304 F+C+N WYH Y H Sbjct: 346 FVCLNFWYHMYGPH 359 >SB_4958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = -2 Query: 348 DFLCVNIWYHQYFSHKYYQKSVV*I*FLFFYYHVLTTINKINIYFYLTLKDR 193 DF C+ W Y S +K+ + I + FY+ L +I+ + L LK + Sbjct: 26 DFYCIYTWEPLYDSRDVTRKTFIPI-LMIFYFIPLVSISVLYCIIILKLKQQ 76 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,978,839 Number of Sequences: 59808 Number of extensions: 191079 Number of successful extensions: 405 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -