BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0672 (571 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF324750-1|AAN75749.1| 563|Drosophila melanogaster N-acetylgala... 29 4.4 AE014296-2565|AAS64999.1| 563|Drosophila melanogaster CG7304-PB... 29 4.4 AE014296-2564|AAF49589.2| 635|Drosophila melanogaster CG7304-PA... 29 4.4 >AF324750-1|AAN75749.1| 563|Drosophila melanogaster N-acetylgalactosaminyltransferase protein. Length = 563 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 291 FDSIYEKNTDDTKCLRIKSQFPIFLVMC-TFNAKRR 395 +DS+ + +TKCL + IFL +C N K+R Sbjct: 510 YDSVSNQLMSNTKCLEFTDELNIFLAICDAANGKQR 545 >AE014296-2565|AAS64999.1| 563|Drosophila melanogaster CG7304-PB, isoform B protein. Length = 563 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 291 FDSIYEKNTDDTKCLRIKSQFPIFLVMC-TFNAKRR 395 +DS+ + +TKCL + IFL +C N K+R Sbjct: 510 YDSVSNQLMSNTKCLEFTDELNIFLAICDAANGKQR 545 >AE014296-2564|AAF49589.2| 635|Drosophila melanogaster CG7304-PA, isoform A protein. Length = 635 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 291 FDSIYEKNTDDTKCLRIKSQFPIFLVMC-TFNAKRR 395 +DS+ + +TKCL + IFL +C N K+R Sbjct: 582 YDSVSNQLMSNTKCLEFTDELNIFLAICDAANGKQR 617 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,487,495 Number of Sequences: 53049 Number of extensions: 271870 Number of successful extensions: 350 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2234671092 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -