BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0672 (571 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003130-3|AAB54123.1| 849|Caenorhabditis elegans Hypothetical ... 27 9.5 AC084197-28|AAO38573.1| 350|Caenorhabditis elegans Serpentine r... 27 9.5 >AF003130-3|AAB54123.1| 849|Caenorhabditis elegans Hypothetical protein F55A12.5 protein. Length = 849 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 246 KHGNKKIKTKSKPRSFDSIYEKNTDD 323 +H N I T SK SFDS E DD Sbjct: 570 RHQNVAISTPSKKESFDSSDEDEEDD 595 >AC084197-28|AAO38573.1| 350|Caenorhabditis elegans Serpentine receptor, class v protein13 protein. Length = 350 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = -3 Query: 326 GIISIFLINTIKRAWFRFSFYFFITMF*LLLTKLIYTFILL*KTDNVTGKK*QINVAK 153 G++ +FL + +F +F + L+T + FI+L K N INV+K Sbjct: 167 GLVPVFLDKQMTTIFFSIGGFFLFANYIYLITAYCFLFIILHKR-NAKLNSLSINVSK 223 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,224,175 Number of Sequences: 27780 Number of extensions: 166615 Number of successful extensions: 343 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 343 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1187327456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -