BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0671 (477 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0002 - 20208-20594,21525-21671,21754-21917,22005-22162,245... 27 5.9 02_01_0500 - 3623837-3624019,3624591-3624778,3625209-3626147,362... 27 7.8 >08_01_0002 - 20208-20594,21525-21671,21754-21917,22005-22162, 24533-24826,24916-25121,25216-25812,26366-27097 Length = 894 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 108 IFFRAIIL*TTVLTVRYCVCGAVTIWVKFYGYYRD 212 +FFR II TV + + + IW F+G+ D Sbjct: 360 LFFRGIINLVTVANISVNLINVIAIWPLFFGWSVD 394 >02_01_0500 - 3623837-3624019,3624591-3624778,3625209-3626147, 3626311-3626479,3626701-3626871,3626948-3627016, 3627094-3627201,3627844-3627997,3628659-3628738, 3628822-3628914,3628951-3629073,3629165-3629915, 3630123-3630163,3630338-3630385 Length = 1038 Score = 27.1 bits (57), Expect = 7.8 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 254 ASIEAISVAAYFSAIPIISVKFNPNSYRTTNTVPHSKYSRSQN 126 A+IEA S + + AI ++NP+ +N+ P S S Q+ Sbjct: 536 AAIEAASFSQQYDAIGWAPKEYNPDDKLNSNSEPQSSGSAPQS 578 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,335,407 Number of Sequences: 37544 Number of extensions: 201011 Number of successful extensions: 390 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 979080328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -