BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0670 (461 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 3.2 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 20 9.7 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.8 bits (44), Expect = 3.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 446 VKYSPQALFEEGYAIVFGKHLWMGVIVFYLSD*F 345 +K Q ++ YA+ F L +GV+V S F Sbjct: 23 IKLEKQTFIQKFYAVAFFLALSIGVVVSIYSKSF 56 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 410 YAIVFGKHLWMGVIVFY 360 Y FG HL GV++ Y Sbjct: 117 YYAFFGVHLAYGVVIIY 133 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 20.2 bits (40), Expect = 9.7 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 Query: 97 QDGRQHKSFSFQYLINTK*TINIHKHVSR 183 Q GR+ F ++ K T + KHV + Sbjct: 401 QCGRRADVLKFWFMWKAKGTSGLEKHVDK 429 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,668 Number of Sequences: 336 Number of extensions: 2172 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10616413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -