BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0668 (384 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36095| Best HMM Match : DMP1 (HMM E-Value=3.2) 39 0.001 SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.32 SB_57270| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.32 SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09) 31 0.32 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 0.32 SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) 29 1.3 SB_3877| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0) 28 2.3 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 28 3.0 SB_18399| Best HMM Match : AMP-binding (HMM E-Value=0) 28 3.0 SB_16595| Best HMM Match : Peptidase_A17 (HMM E-Value=9.1e-11) 28 3.0 SB_19560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.0 SB_27523| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-09) 27 4.0 SB_9925| Best HMM Match : Kinesin (HMM E-Value=0.00094) 27 4.0 SB_43297| Best HMM Match : Astacin (HMM E-Value=3.5e-31) 27 5.2 SB_23501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_1496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_11301| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_42806| Best HMM Match : MORN (HMM E-Value=0) 27 6.9 SB_54676| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 26 9.2 SB_11074| Best HMM Match : efhand (HMM E-Value=1.79366e-43) 26 9.2 SB_9368| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_51338| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_43176| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_15358| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.03) 26 9.2 SB_14129| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 >SB_36095| Best HMM Match : DMP1 (HMM E-Value=3.2) Length = 939 Score = 39.1 bits (87), Expect = 0.001 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +3 Query: 123 PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYSSAESV 296 PA AP A+ YP +P P VPG P+ P P VPG P+ P + + SV Sbjct: 869 PAQAPGYPAQAPGYPAQVPGYPAQVPGYPAQAPGCPAQVPGYPAQVPGYPAQVPAGSSV 927 Score = 34.3 bits (75), Expect = 0.035 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +3 Query: 99 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSC-YHTSPL 272 +P PA P A+ YP P P VPG P+ +P P VP S Y +SP Sbjct: 875 YPAQAPGYPAQVPGYPAQVPGYPAQAPGCPAQVPGYPAQVPGYPAQVPAGSSVQYVSSPQ 934 Query: 273 RY 278 ++ Sbjct: 935 QF 936 Score = 27.9 bits (59), Expect = 3.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 174 PRGPCSVPGRPSCLPRGPCSVPGRPS 251 P P PG P+ P P VPG P+ Sbjct: 866 PGNPAQAPGYPAQAPGYPAQVPGYPA 891 >SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 526 Score = 32.7 bits (71), Expect = 0.11 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 5/54 (9%) Frame = +3 Query: 135 PRCQAR--CCY---PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PRC C Y PC PC RP C PC RP Y P RY+ Sbjct: 183 PRCYTLRPCRYMLRPCRYMLRPCRYMLRPCCYTLRPCRYMLRPCRYTLRPCRYT 236 Score = 31.9 bits (69), Expect = 0.18 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRY 278 PC PC RP C PC RP Y P RY Sbjct: 169 PCRYTLRPCRYTLRPRCYTLRPCRYMLRPCRYMLRPCRY 207 Score = 31.5 bits (68), Expect = 0.24 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 153 CCY---PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 CCY PC PC RP PC RP Y P RY+ Sbjct: 212 CCYTLRPCRYMLRPCRYTLRPCRYTLRPCRYTLRPCRYTLRPCRYT 257 Score = 28.7 bits (61), Expect = 1.7 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PC PC RP PC RP Y P RY+ Sbjct: 260 PCGYTLRPCGYTLRPHRYTLRPCRYTLRPCRYTLRPCRYT 299 Score = 28.3 bits (60), Expect = 2.3 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PC PC RP PC RP Y P RY+ Sbjct: 246 PCRYTLRPCRYTLRPCGYTLRPCGYTLRPHRYTLRPCRYT 285 Score = 27.9 bits (59), Expect = 3.0 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PC PC RP PC RP Y P RY+ Sbjct: 281 PCRYTLRPCRYTLRPCRYTLRPCRYTLRPRRYTLRPCRYT 320 Score = 27.9 bits (59), Expect = 3.0 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PC PC RP C PC R Y P Y+ Sbjct: 386 PCRYTLSPCRYTLRPRCCTLRPCRYTLRTCRYALRPRHYT 425 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PC PC RP PC RP Y P RY+ Sbjct: 211 PCCYTLRPCRYMLRPCRYTLRPCRYTLRPCRYTLRPCRYT 250 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PC PC RP PC RP Y P RY+ Sbjct: 239 PCRYTLRPCRYTLRPCRYTLRPCGYTLRPCGYTLRPHRYT 278 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PC PC RP PC RP Y P RY+ Sbjct: 456 PCRYTLRPCRYMLRPCRYRLRPCGYTLRPCRYMLRPCRYT 495 Score = 27.1 bits (57), Expect = 5.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PC PC RP PC RP Y P RY+ Sbjct: 204 PCRYMLRPCCYTLRPCRYMLRPCRYTLRPCRYTLRPCRYT 243 Score = 26.6 bits (56), Expect = 6.9 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRY 278 PC PC RP PC RP Y P RY Sbjct: 435 PCRYTLRPCRYMLRPCRYMLRPCRYTLRPCRYMLRPCRY 473 Score = 26.6 bits (56), Expect = 6.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYS 281 PC PC RP PC RP Y P RY+ Sbjct: 463 PCRYMLRPCRYRLRPCGYTLRPCRYMLRPCRYTLRPCRYT 502 Score = 26.2 bits (55), Expect = 9.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRY 278 PC PC RP PC RP Y P RY Sbjct: 449 PCRYMLRPCRYTLRPCRYMLRPCRYRLRPCGYTLRPCRY 487 >SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1530 Score = 31.1 bits (67), Expect = 0.32 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +3 Query: 102 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHT 263 P+ C+ + C ++C C P G RG C PG+ SCYH+ Sbjct: 770 PRDCSNMNSDPNACNSKCVDGCFCPEGKIQ--------DRGKCVDPGQCSCYHS 815 >SB_57270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 31.1 bits (67), Expect = 0.32 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 2/69 (2%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSP--LRYSSAESVSSQNIVRHDQPQT 335 P ++ PC+V P + PC+V P SP +++S S V+H P T Sbjct: 103 PYTVQHSPCTVQHSPYTVQHSPCTVQHSPYTVQHSPYTVQHSPYAVQHSPYTVQH-SPYT 161 Query: 336 IQYAAPVAK 362 +Q++ A+ Sbjct: 162 VQHSPYTAQ 170 >SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09) Length = 133 Score = 31.1 bits (67), Expect = 0.32 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +3 Query: 102 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHT 263 P+ C+ + C ++C C P G RG C PG+ SCYH+ Sbjct: 71 PRDCSNMNSDPNACNSKCVDGCFCPEGKIQ--------DRGKCVDPGQCSCYHS 116 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.1 bits (67), Expect = 0.32 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +3 Query: 123 PASAPRCQARCC--YPCSLPRGPCSVPGRPSCLPRG-PCSVPGRPS 251 P+ AP CC YP P P + P +P+ PR P + P P+ Sbjct: 507 PSCAPTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPPAAAPCNPA 552 Score = 28.7 bits (61), Expect = 1.7 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +3 Query: 135 PRC-QARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYSSAESVSSQ 305 P C Q RCC ++P+GP P P + + P +P P +P+ A Q Sbjct: 441 PICIQHRCCN-ANMPQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQ 497 >SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) Length = 1152 Score = 29.1 bits (62), Expect = 1.3 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 159 YPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTS 266 YP + PC +P SC P+ PCS PG Y TS Sbjct: 736 YPPYTGQVPC-LPS--SCTPQNPCSPPGCTPQYSTS 768 >SB_3877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 159 YPCSLPRGPCSVPGRPSCLPRGPCSVP 239 + C LP C +P CLP C +P Sbjct: 27 HKCGLPYNECGLPYNKCCLPYTNCGLP 53 >SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 689 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 126 ASAPRCQARCCY--PCSLPRGPCSVPGRPSCLPRGPC 230 AS + A C Y PCS G CSV G +C PC Sbjct: 2 ASCLQVTATCSYGNPCS-NGGSCSVDGSETCSNSNPC 37 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 27.9 bits (59), Expect = 3.0 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +3 Query: 156 CYPCSLPRGPCSVPGRPSCLPRGPCSVPG-RPSCYHT 263 C C++PR C++P LP C++P P C T Sbjct: 846 CMMCAIPRVICAIPRVMYALPCVMCAIPRVIPPCAST 882 >SB_18399| Best HMM Match : AMP-binding (HMM E-Value=0) Length = 1381 Score = 27.9 bits (59), Expect = 3.0 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 34 VAVSKAGLLAAPVHYAPAEAVSSQS 108 VAV K+ L +P PA AVSSQS Sbjct: 1081 VAVDKSSWLGSPPFLLPARAVSSQS 1105 >SB_16595| Best HMM Match : Peptidase_A17 (HMM E-Value=9.1e-11) Length = 1692 Score = 27.9 bits (59), Expect = 3.0 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +3 Query: 159 YPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSC---YHTSPLRYSSAES 293 YP + P ++PG S P ++PG PS Y T+ RY A + Sbjct: 332 YPSANTGYPTAIPGYSSANTGYPTAIPGYPSANTGYPTATPRYPPAST 379 >SB_19560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 4.0 Identities = 25/93 (26%), Positives = 37/93 (39%), Gaps = 4/93 (4%) Frame = +3 Query: 117 P*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSP-LRYSSAES 293 P A+ C A PCS PCS P P RP+ HT P L ++ Sbjct: 34 PRSATLAPCSATLA-PCSATLAPCSALTCPMLGHTRPTLGHTRPTLGHTRPTLGHTRPML 92 Query: 294 VSSQNIVRHDQP---QTIQYAAPVAKLAVSCSR 383 ++ ++ H P T + A V + +C+R Sbjct: 93 GHTRPMLGHTHPLLGHTCRLIAKVYSVGQNCNR 125 >SB_27523| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-09) Length = 666 Score = 27.5 bits (58), Expect = 4.0 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 135 PRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSP 269 P QAR Y L GP ++PG P +P+ + PG + SP Sbjct: 339 PTPQARWIYQEELCTGPETIPG-PEMIPKSTPTDPGTRNDTEESP 382 >SB_9925| Best HMM Match : Kinesin (HMM E-Value=0.00094) Length = 1671 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 189 SVPGRPSCLPRGPCSVPGRPSCYHTSPLRYSSAESVSSQ 305 SVPG P+C+PRG R Y + + E V S+ Sbjct: 1389 SVPGTPACVPRGKSISKLRLFRYDAAERVFDEGEDVFSR 1427 >SB_43297| Best HMM Match : Astacin (HMM E-Value=3.5e-31) Length = 716 Score = 27.1 bits (57), Expect = 5.2 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = +3 Query: 180 GPCSVPGRPSCLPRGPCSVPGRPSCYHTSPLRYSSAESVSSQNIVRHDQPQTIQYAAPVA 359 GP V G + L P V + H + R S+ ++ +++NI RH + + Sbjct: 622 GPSHVQGSRTRLRTSPYGVCAQVDGKHFNASRKSAVQNRNNENIGRHSSHHNARQTTRLC 681 Query: 360 KLAVS 374 L VS Sbjct: 682 LLPVS 686 >SB_23501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 27.1 bits (57), Expect = 5.2 Identities = 15/50 (30%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 111 CAP*PASAPRCQARC-CYPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCY 257 C P +CQ Y C +G P R SC CS+ P Y Sbjct: 127 CQTNPCGGAQCQNTLGSYYCGCAQGNILAPNRRSCQDINECSMGINPCSY 176 >SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 27.1 bits (57), Expect = 5.2 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 159 YPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHT 263 YP + PC +P SC P+ PCS PG Y T Sbjct: 255 YPPYTGQIPC-LPS--SCAPQNPCSPPGCTPQYST 286 >SB_1496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 27.1 bits (57), Expect = 5.2 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 156 CYPCSLPR-GPCSVPGRPSCLPRGPCSVPG 242 C C P C +PG SC P G S PG Sbjct: 478 CASCPPPGCASCPLPGCASCQPPGCASCPG 507 >SB_11301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 26.6 bits (56), Expect = 6.9 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +3 Query: 195 PGRPSCLPRGPC----SVPGRPSCYHTSPLRYSSAESVSSQNIV 314 P R SC PC S P R SC+ T P + + + + Q V Sbjct: 22 PARRSCHTTQPCKGQLSHPARSSCHTTQPCKEKLSHNTTLQGEV 65 >SB_42806| Best HMM Match : MORN (HMM E-Value=0) Length = 778 Score = 26.6 bits (56), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 61 PEVQLSTPRPKRTVLRFWRT 2 PEVQL +P P++ + +W T Sbjct: 653 PEVQLPSPPPEQDNMHYWET 672 >SB_54676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 926 Score = 26.2 bits (55), Expect = 9.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 25 CALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQ 126 C L+A S L P+HYA +A S ++ D+ Sbjct: 212 CKLIAQSGTRLERTPLHYAALKAASLNAVYDVDE 245 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 26.2 bits (55), Expect = 9.2 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 141 CQARCCYPCSLPRGPCSVPG----RPSCLPRGPCSVPGRPSC 254 C+A+C P + G V R SC P S PGR SC Sbjct: 62 CKAQCILPSLISNGVARVRDGTTIRYSCNPGYTRSGPGRASC 103 >SB_11074| Best HMM Match : efhand (HMM E-Value=1.79366e-43) Length = 779 Score = 26.2 bits (55), Expect = 9.2 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = -2 Query: 371 DGQLGYRS--GVLDSLGLVMTDD 309 DG+L + VLDSLGL MTDD Sbjct: 685 DGKLSRKEFREVLDSLGLYMTDD 707 >SB_9368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 26.2 bits (55), Expect = 9.2 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = +3 Query: 252 CYHTSPLRYSSAESVSSQNIVRHDQPQTIQYAAPVAKLAVSC 377 C H P A+ + N RHD + A + KL+ C Sbjct: 291 CGHLHPKPLVIADRFNFHNRFRHDSETVADFGAQLKKLSTHC 332 >SB_51338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 26.2 bits (55), Expect = 9.2 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 171 LPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSPL 272 +P G V R +C+P G V R +C P+ Sbjct: 203 IPHGGLLVLSRSTCIPHGGLLVLSRSTCRRAYPM 236 >SB_43176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 26.2 bits (55), Expect = 9.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 377 AADGQLGYRSGVLDSLGLVMTDDVLGRDRF 288 + DG GY SGV + L TD G+ RF Sbjct: 513 SGDGSEGYGSGVTSGVDLPFTDIKGGQGRF 542 >SB_15358| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.03) Length = 435 Score = 26.2 bits (55), Expect = 9.2 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 156 CYPCSLPRGPCSVPGRPSCLPRGPCSVPGRP 248 C P LP P +PG P LP P +P P Sbjct: 204 CLPGVLPGLPGVLPGLPGVLPGLPGVLPALP 234 Score = 26.2 bits (55), Expect = 9.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 162 PCSLPRGPCSVPGRPSCLPRGPCSVPGRPSCYHTSP 269 P LP P +PG P LP P +PG P P Sbjct: 213 PGVLPGLPGVLPGLPGVLPALPGVLPGLPGVLPALP 248 >SB_14129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 26.2 bits (55), Expect = 9.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 259 TLLHSATPRLNLSRPKTSSVMTSPRLS 339 +L+ S TPR N+S K ++ SPR S Sbjct: 12 SLIQSRTPRYNMSTVKATTRPPSPRTS 38 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.125 0.343 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,150,391 Number of Sequences: 59808 Number of extensions: 178958 Number of successful extensions: 716 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 656970245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits)
- SilkBase 1999-2023 -