BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0668 (384 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 33 0.004 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 32 0.008 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 32 0.008 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 32 0.008 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 32 0.008 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 32 0.008 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 31 0.014 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 30 0.025 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 29 0.077 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 29 0.077 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 29 0.077 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 29 0.077 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 27 0.18 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 24 2.2 AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 24 2.2 AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like pepti... 24 2.2 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 2.2 AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical prote... 23 3.8 EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle... 22 8.9 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 22 8.9 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 22 8.9 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 33.1 bits (72), Expect = 0.004 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S SI H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSSIQHHAAPAIH 44 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 31.9 bits (69), Expect = 0.008 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 31.9 bits (69), Expect = 0.008 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 31.9 bits (69), Expect = 0.008 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 31.9 bits (69), Expect = 0.008 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 31.9 bits (69), Expect = 0.008 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 31.1 bits (67), Expect = 0.014 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIASSHSTIQHHAAPAIH 44 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 30.3 bits (65), Expect = 0.025 Identities = 20/46 (43%), Positives = 23/46 (50%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA AGLL PV + A S SI H P +H Sbjct: 1 MAFKFVLLATLVAAVSAGLL--PVANHGSIATSHSSIQHHAAPAIH 44 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 28.7 bits (61), Expect = 0.077 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQL 135 M K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAI 43 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 28.7 bits (61), Expect = 0.077 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQL 135 M K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPTI 43 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 28.7 bits (61), Expect = 0.077 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQL 135 M K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAI 43 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 28.7 bits (61), Expect = 0.077 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQL 135 M K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPTI 43 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 27.5 bits (58), Expect = 0.18 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQL 135 M K V+ LVA + AGLL PV + + A S +I H +P + Sbjct: 1 MAFKFVLFTTLVAAASAGLL--PVAHHGSIATSHSTIQHHARPAI 43 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.8 bits (49), Expect = 2.2 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 174 PRGPCSVPGRPSCLPRGPCSVPGRPSCYHT-SPLRYS 281 P PG S P GP +P + + T + LR+S Sbjct: 111 PSAASESPGSVSSQPSGPIHIPAKRPAFDTDTRLRHS 147 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 23.8 bits (49), Expect = 2.2 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 13 IVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 + +L ALV + +++A Y AE V S + + P LH Sbjct: 12 LYILQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLH 53 >AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like peptide 3 precursor protein. Length = 160 Score = 23.8 bits (49), Expect = 2.2 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 13 IVVLCALVAVSKAGLLAAPVHYAPAEAVSSQSIVRHDQPQLH 138 + +L ALV + +++A Y AE V S + + P LH Sbjct: 12 LYILQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLH 53 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.8 bits (49), Expect = 2.2 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 32 WSRCRKLDFWLLPCTTLPLKPFLPKALCA 118 WS C+KL F C P P LC+ Sbjct: 31 WSLCQKLHFRDQVCCVQRSPPHWPYLLCS 59 >AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical protein protein. Length = 104 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +3 Query: 126 ASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSC 254 A A C C PC +P + G L G C P R C Sbjct: 15 ALATLCHGACDEPCPVPPKHYAELGCKPILEEGQC-CPKRYQC 56 >EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle protein protein. Length = 178 Score = 21.8 bits (44), Expect = 8.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYAPA 87 M K V+L ALVA AG AA AP+ Sbjct: 1 MAFKFVILAALVAAVSAGGPAAYSIAAPS 29 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 21.8 bits (44), Expect = 8.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 52 GLLAAPVHYAPAEAVSSQS 108 G +PVH APA VSS S Sbjct: 221 GASLSPVHTAPAIPVSSCS 239 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 21.8 bits (44), Expect = 8.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 327 AGHDGRCFGTRQIQPRSSGVE 265 AG D GTR + PR GV+ Sbjct: 387 AGQDYTIPGTRHVIPRHVGVQ 407 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.125 0.343 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 334,895 Number of Sequences: 2352 Number of extensions: 6115 Number of successful extensions: 28 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits)
- SilkBase 1999-2023 -