BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0666 (566 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC052289-1|AAH52289.1| 421|Homo sapiens CPA4 protein protein. 33 0.53 AY358699-1|AAQ89062.1| 421|Homo sapiens CPA4 protein. 33 0.53 AF095719-1|AAF23230.1| 421|Homo sapiens carboxypeptidase A3 pro... 33 0.53 >BC052289-1|AAH52289.1| 421|Homo sapiens CPA4 protein protein. Length = 421 Score = 33.5 bits (73), Expect = 0.53 Identities = 15/34 (44%), Positives = 25/34 (73%) Frame = -1 Query: 194 LNVRSGEQVSKISSQDQSSRILRFFFWKCPANCN 93 +NVR+G+++SK+ SQ +S L+ FWK P++ N Sbjct: 29 INVRNGDEISKL-SQLVNSNNLKLNFWKSPSSFN 61 >AY358699-1|AAQ89062.1| 421|Homo sapiens CPA4 protein. Length = 421 Score = 33.5 bits (73), Expect = 0.53 Identities = 15/34 (44%), Positives = 25/34 (73%) Frame = -1 Query: 194 LNVRSGEQVSKISSQDQSSRILRFFFWKCPANCN 93 +NVR+G+++SK+ SQ +S L+ FWK P++ N Sbjct: 29 INVRNGDEISKL-SQLVNSNNLKLNFWKSPSSFN 61 >AF095719-1|AAF23230.1| 421|Homo sapiens carboxypeptidase A3 protein. Length = 421 Score = 33.5 bits (73), Expect = 0.53 Identities = 15/34 (44%), Positives = 25/34 (73%) Frame = -1 Query: 194 LNVRSGEQVSKISSQDQSSRILRFFFWKCPANCN 93 +NVR+G+++SK+ SQ +S L+ FWK P++ N Sbjct: 29 INVRNGDEISKL-SQLVNSNNLKLNFWKSPSSFN 61 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,700,119 Number of Sequences: 237096 Number of extensions: 1216331 Number of successful extensions: 1812 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1812 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5759818212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -