BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0666 (566 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT021392-1|AAX33540.1| 518|Drosophila melanogaster LD20874p pro... 29 3.3 AY061247-1|AAL28795.1| 294|Drosophila melanogaster LD18613p pro... 29 3.3 AE014134-3517|ABC65923.1| 415|Drosophila melanogaster CG2201-PD... 29 3.3 AE014134-3516|AAN11129.1| 415|Drosophila melanogaster CG2201-PC... 29 3.3 AE014134-3515|AAN11128.1| 554|Drosophila melanogaster CG2201-PB... 29 3.3 AE014134-3514|AAF57221.2| 518|Drosophila melanogaster CG2201-PA... 29 3.3 >BT021392-1|AAX33540.1| 518|Drosophila melanogaster LD20874p protein. Length = 518 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = -1 Query: 230 IIHYVRLFHEDWLNVRSGEQVSKISSQDQSSRILRFFFW 114 I++Y++ FH+D +G+++ K+ ++ Q +L FW Sbjct: 443 IVNYLKKFHDDENYNITGQELMKVDAEIQFFTMLSHLFW 481 >AY061247-1|AAL28795.1| 294|Drosophila melanogaster LD18613p protein. Length = 294 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = -1 Query: 230 IIHYVRLFHEDWLNVRSGEQVSKISSQDQSSRILRFFFW 114 I++Y++ FH+D +G+++ K+ ++ Q +L FW Sbjct: 219 IVNYLKKFHDDENYNITGQELMKVDAEIQFFTMLSHLFW 257 >AE014134-3517|ABC65923.1| 415|Drosophila melanogaster CG2201-PD, isoform D protein. Length = 415 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = -1 Query: 230 IIHYVRLFHEDWLNVRSGEQVSKISSQDQSSRILRFFFW 114 I++Y++ FH+D +G+++ K+ ++ Q +L FW Sbjct: 340 IVNYLKKFHDDENYNITGQELMKVDAEIQFFTMLSHLFW 378 >AE014134-3516|AAN11129.1| 415|Drosophila melanogaster CG2201-PC, isoform C protein. Length = 415 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = -1 Query: 230 IIHYVRLFHEDWLNVRSGEQVSKISSQDQSSRILRFFFW 114 I++Y++ FH+D +G+++ K+ ++ Q +L FW Sbjct: 340 IVNYLKKFHDDENYNITGQELMKVDAEIQFFTMLSHLFW 378 >AE014134-3515|AAN11128.1| 554|Drosophila melanogaster CG2201-PB, isoform B protein. Length = 554 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = -1 Query: 230 IIHYVRLFHEDWLNVRSGEQVSKISSQDQSSRILRFFFW 114 I++Y++ FH+D +G+++ K+ ++ Q +L FW Sbjct: 479 IVNYLKKFHDDENYNITGQELMKVDAEIQFFTMLSHLFW 517 >AE014134-3514|AAF57221.2| 518|Drosophila melanogaster CG2201-PA, isoform A protein. Length = 518 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = -1 Query: 230 IIHYVRLFHEDWLNVRSGEQVSKISSQDQSSRILRFFFW 114 I++Y++ FH+D +G+++ K+ ++ Q +L FW Sbjct: 443 IVNYLKKFHDDENYNITGQELMKVDAEIQFFTMLSHLFW 481 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,483,341 Number of Sequences: 53049 Number of extensions: 353814 Number of successful extensions: 834 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2213979693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -