BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0664 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 56 3e-10 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 23 2.3 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 9.2 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 56.0 bits (129), Expect = 3e-10 Identities = 25/55 (45%), Positives = 35/55 (63%) Frame = -2 Query: 420 IDAASYGSAARFMNHSCEASAAAVRVFTRHRDLRLPLVVLFATRDIHPGEPLTFD 256 +DAA YG+ + F+NHSC+ + A V+ D LP + LFAT+DI E +TFD Sbjct: 566 VDAAIYGNISHFINHSCDPNLAVYGVWINCLDPNLPKLALFATKDIKQNEEITFD 620 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 73 LYICNRCNKCYIRNKNIPIKH 11 LY+C CN+ Y R KN H Sbjct: 35 LYVCEFCNRRY-RTKNSLTTH 54 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.0 bits (42), Expect = 9.2 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -3 Query: 473 NWVPGPPSSNV 441 NW+ G P +NV Sbjct: 342 NWIKGTPQNNV 352 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,391 Number of Sequences: 438 Number of extensions: 2570 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -