BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0662 (612 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 3.5 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 3.5 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 3.5 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +2 Query: 482 PTDTPASFNSGRPAETPAFRGGSKNLKGSTRYC*PTVAYSSGG 610 P+DT N+ T A LK T Y +AY+SGG Sbjct: 1142 PSDTWFDENTKDTKITAASETILHGLKKYTNYSMEVLAYTSGG 1184 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 3.5 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 202 ESFRLGCPPHAGGGIGLERVVMLYLGLDNIRKTSMFPRDPKRVTP 68 E+F L P H L R+ + +D++ ++F RD RV P Sbjct: 78 ENFSLFIPKHRKVAGKLIRIFLAAESIDDLLSNAVFCRD--RVNP 120 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,561 Number of Sequences: 336 Number of extensions: 3560 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -