BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0661 (600 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q55GD8 Cluster: Putative uncharacterized protein; n=1; ... 33 6.8 UniRef50_Q2HDF9 Cluster: Predicted protein; n=1; Chaetomium glob... 32 9.0 >UniRef50_Q55GD8 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 551 Score = 32.7 bits (71), Expect = 6.8 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = +1 Query: 397 PKATTSTTKTGRLRKR-SHSLRPSHFSEP--CPRHSLRPPKKDYHINR*TD 540 PK TTS TKT R K + +P+H ++P P+H+ +P + H + T+ Sbjct: 120 PKHTTSPTKTPRPTKTPKPTEKPNHTTKPTETPKHTTKPTETPKHTTKPTE 170 >UniRef50_Q2HDF9 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 498 Score = 32.3 bits (70), Expect = 9.0 Identities = 21/58 (36%), Positives = 25/58 (43%) Frame = -1 Query: 435 QSPSLCR*GSRLRKDLSATHPRRCILHFSQFSLHHPPWSVAIPSL*YPFDQH*APTSP 262 QSPSL R S L S+ H + LH+ LH+ W P P H PT P Sbjct: 177 QSPSLYRQPSSLHHQTSSLHHQPSSLHYQPSPLHYESW----PQDCAPTPYHSLPTPP 230 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,536,151 Number of Sequences: 1657284 Number of extensions: 9913479 Number of successful extensions: 24287 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24280 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 42317807226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -