BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0661 (600 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 27 0.19 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 24 0.99 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 1.7 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 23 1.7 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 23 1.7 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 23 1.7 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 23 1.7 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 23 1.7 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 23 1.7 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 23 1.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 1.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 1.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 1.7 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 4.0 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 26.6 bits (56), Expect = 0.19 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + GR R R H + PSH+ E P Sbjct: 315 SRDRRGRGRSREHRIIPSHYIEQIP 339 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 24.2 bits (50), Expect = 0.99 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +1 Query: 394 FPKATTSTTKTGRLRKRSHSLRPSHF-SEPCPRHSLRPPKKDYHINR*TDRFDQ 552 + K +S+ R S S PS S+P H+ K ++H N+ T++ +Q Sbjct: 24 YSKRFSSSIVDRRSPSSSRSPSPSLLTSQPHQDHNKEKSKNNHHCNQDTEKLNQ 77 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 23.4 bits (48), Expect = 1.7 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 Query: 44 LRLPYGPMLPKRPLS 88 L +PYGP++P++ L+ Sbjct: 649 LNVPYGPVIPEQSLT 663 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 67 SRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 67 SRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 67 SRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 67 SRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 67 SRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 67 SRDRRERGRSREHRIIPSHYIEQIP 91 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 67 SRDRRERGRSREHRIIPSHYIEQIP 91 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 316 SRDRRERGRSREHRIIPSHYIEQIP 340 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 316 SRDRRERGRSREHRIIPSHYIEQIP 340 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 316 SRDRRERGRSREHRIIPSHYIEQIP 340 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 316 SRDRRERGRSREHRIIPSHYIEQIP 340 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 316 SRDRRERGRSREHRIIPSHYIEQIP 340 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 316 SRDRRERGRSREHRIIPSHYIEQIP 340 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 300 SRDRRERGRSREHRIIPSHYIEQIP 324 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 412 STTKTGRLRKRSHSLRPSHFSEPCP 486 S + R R R H + PSH+ E P Sbjct: 316 SRDRRERGRSREHRIIPSHYIEQIP 340 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.2 bits (45), Expect = 4.0 Identities = 5/16 (31%), Positives = 12/16 (75%) Frame = -2 Query: 599 FPIWLMMFHPRFWVYH 552 FP+ M+F+ +W+++ Sbjct: 472 FPVSFMLFNAIYWIFY 487 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,411 Number of Sequences: 438 Number of extensions: 3078 Number of successful extensions: 20 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -