BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0656 (388 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr... 26 1.8 SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|... 25 3.1 SPAC57A7.07c |||homocysteine methyltransferase |Schizosaccharomy... 25 3.1 SPAC1071.05 |||S-adenosylmethionine-dependent methyltransferase ... 25 4.1 SPAC23C4.10 |sec2||guanyl-nucleotide exchange factor Sec2 |Schiz... 24 7.2 SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomy... 24 9.6 SPCC1322.06 |kap113||karyopherin Kap113|Schizosaccharomyces pomb... 24 9.6 >SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr 2|||Manual Length = 1471 Score = 26.2 bits (55), Expect = 1.8 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 255 SSLVEPISVRKIENLRNMGQQTSQLKVENAPVDVEPGKEDAMLN 386 S ++E ++ ++++N RN+GQ S + N P EP A+ N Sbjct: 45 SGVLETVNYQQLQN-RNIGQSESPSDLTNLPYLNEPSVLHALHN 87 >SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1234 Score = 25.4 bits (53), Expect = 3.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 237 SSFKFAYFLNFCRFSSCRMFIYKKFVCKISHGTLNLSIVHF 115 S F+ + +N+ FS+ F+CKIS NL VHF Sbjct: 75 SLFETSVGMNWKSFSNKEKESVTSFLCKISLEDNNLLSVHF 115 >SPAC57A7.07c |||homocysteine methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 308 Score = 25.4 bits (53), Expect = 3.1 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 91 FPEIITKRKVYNRQI*SAVTNFTYEL--LVYKHSTRGKPTK 207 +PEI+ K ++ ++ FTY+L +Y G P K Sbjct: 33 YPEIVVKHHEEFLKVCDIISTFTYQLDASIYDEKVEGVPLK 73 >SPAC1071.05 |||S-adenosylmethionine-dependent methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 339 Score = 25.0 bits (52), Expect = 4.1 Identities = 11/19 (57%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = +2 Query: 272 YQCTKDR-KSEEHGTADVS 325 Y CT++ SE+HGT DVS Sbjct: 179 YFCTQEHDSSEKHGTIDVS 197 >SPAC23C4.10 |sec2||guanyl-nucleotide exchange factor Sec2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 527 Score = 24.2 bits (50), Expect = 7.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 102 HNKEESVQSTNLKCRD 149 HN EE +Q T KCR+ Sbjct: 84 HNLEEKLQLTETKCRN 99 >SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 23.8 bits (49), Expect = 9.6 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +3 Query: 78 SLINISRNHNKEESV 122 S+I+IS +HNKEE + Sbjct: 44 SIIDISVHHNKEEEI 58 >SPCC1322.06 |kap113||karyopherin Kap113|Schizosaccharomyces pombe|chr 3|||Manual Length = 983 Score = 23.8 bits (49), Expect = 9.6 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 39 SKIVNVTL*ILNYSLINISRNHNKEESVQSTNL 137 +K +N+ + I N+ L+N NH+K+ + + L Sbjct: 833 TKNINIAMLIGNWILLNDHINHSKDRKLNTLAL 865 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,613,318 Number of Sequences: 5004 Number of extensions: 32756 Number of successful extensions: 89 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 128344734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -