BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0651 (648 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4M492 Cluster: Major facilitator superfamily MFS_1; n=... 33 6.0 UniRef50_Q22N52 Cluster: Putative uncharacterized protein; n=1; ... 33 7.9 >UniRef50_A4M492 Cluster: Major facilitator superfamily MFS_1; n=3; Desulfuromonadales|Rep: Major facilitator superfamily MFS_1 - Geobacter bemidjiensis Bem Length = 398 Score = 33.1 bits (72), Expect = 6.0 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +3 Query: 3 SSLYFLIIYMYILDNSLYNFQDLK*QYFSPI 95 S+ +L+++MYILDN LYNF+ YF + Sbjct: 297 STSKYLVMFMYILDNILYNFEVSIRTYFQKV 327 >UniRef50_Q22N52 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1483 Score = 32.7 bits (71), Expect = 7.9 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = -1 Query: 204 SVILDNNHSHNYIVAVHSFNNFKELTLNLSTSYILSV*VKN 82 S+ L +++HN+ A+ SFN F + + TSYIL ++N Sbjct: 1221 SLGLIESYTHNFSYALTSFNRFNDAQSYIQTSYILKQQIQN 1261 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,059,714 Number of Sequences: 1657284 Number of extensions: 10464640 Number of successful extensions: 20806 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20804 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -