BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0645 (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78410-3|CAB01641.1| 555|Caenorhabditis elegans Hypothetical pr... 28 5.8 Z75549-8|CAD60424.1| 297|Caenorhabditis elegans Hypothetical pr... 27 7.7 >Z78410-3|CAB01641.1| 555|Caenorhabditis elegans Hypothetical protein C51E3.6 protein. Length = 555 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 429 LETVSVIYTAILFVPLALTSSLCSGS 352 L+ V V +A+L VPL + S+C GS Sbjct: 37 LQQVMVCVSALLTVPLIMADSMCPGS 62 >Z75549-8|CAD60424.1| 297|Caenorhabditis elegans Hypothetical protein T19C4.9 protein. Length = 297 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 345 VSSYRCTGMTSMLGVRTKSLYILQTPSLTFH 437 +S+Y+ M S + T+ +Y+L TP+L F+ Sbjct: 143 LSTYKVVIMESEIRYSTRDIYVLVTPNLPFN 173 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,966,688 Number of Sequences: 27780 Number of extensions: 258729 Number of successful extensions: 396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -