BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0645 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.0 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 9.2 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 9.2 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 4.0 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = +1 Query: 433 FTKSRCVDLIPTSKACSRTFHLVNNWDSDVCKLGEPRLRVLLVMSILNVWI 585 F+ SRC I S C R D K+ E V +V+ L +WI Sbjct: 475 FSHSRCPPEIHKSCICVRFIAEHTKMLEDSTKVKEDWKYVAMVLDRLFLWI 525 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 4.0 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = +1 Query: 433 FTKSRCVDLIPTSKACSRTFHLVNNWDSDVCKLGEPRLRVLLVMSILNVWI 585 F+ SRC I S C R D K+ E V +V+ L +WI Sbjct: 475 FSHSRCPPEIHKSCICVRFIAEHTKMLEDSTKVKEDWKYVAMVLDRLFLWI 525 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 493 EMFWNTLCWLELNLHT 446 E FWN++ + E LHT Sbjct: 544 EDFWNSINFNENKLHT 559 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 493 EMFWNTLCWLELNLHT 446 E FWN++ + E LHT Sbjct: 544 EDFWNSINFNENKLHT 559 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,679 Number of Sequences: 438 Number of extensions: 3279 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -