BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0645 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38430.1 68415.m04720 expressed protein 31 0.58 At4g11750.1 68417.m01874 kelch repeat-containing F-box family pr... 28 5.4 >At2g38430.1 68415.m04720 expressed protein Length = 393 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 335 PAYRK*LPLHRDDVNARGTNKIAVYITDTVSNVSLKVG 448 P+Y K +PL D V R K ++ + + V NV++ +G Sbjct: 69 PSYVKFVPLSSDSVECRKGEKPSILMNNNVQNVNMNIG 106 >At4g11750.1 68417.m01874 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 386 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +3 Query: 270 LN*SS*VTRYFFQLLNLHKYKTRLIVSSYRCTGMTSMLGVRTKSLYI 410 LN + V+R ++ +L+L + R +V+S + +LG R K LY+ Sbjct: 17 LNCLARVSRLYYPILSLVSKRFRSLVASLELYEIRKLLGHREKCLYL 63 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,952,873 Number of Sequences: 28952 Number of extensions: 229841 Number of successful extensions: 380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -