BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0643 (541 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.0 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.0 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 9.2 EF222299-1|ABN79659.1| 136|Tribolium castaneum ion transport pe... 21 9.2 EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport pe... 21 9.2 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 9.2 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 435 KCTYLT*PKSWRSTKPVSRLYRF 503 KC Y+ P+ + K RL+RF Sbjct: 229 KCIYVFNPRYYLEKKVTRRLHRF 251 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 435 KCTYLT*PKSWRSTKPVSRLYRF 503 KC Y+ P+ + K RL+RF Sbjct: 229 KCIYVFNPRYYLEKKVTRRLHRF 251 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 20.6 bits (41), Expect = 9.2 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 268 SITPREDRRMRSFVPRQVPDSPLRSHHR*TNIR 366 S+ + + R FVPR+VP + R NI+ Sbjct: 319 SVEGQLEFRALLFVPRRVPFDLFENKKRKNNIK 351 >EF222299-1|ABN79659.1| 136|Tribolium castaneum ion transport peptide isoform C protein. Length = 136 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 66 YHAGCWYTENGSELSRQLDLWLSK 137 Y GC T S+ Q+ LW+ + Sbjct: 94 YFKGCIDTLQRSDEEAQIQLWIKQ 117 >EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport peptide isoform A protein. Length = 140 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 66 YHAGCWYTENGSELSRQLDLWLSK 137 Y GC T S+ Q+ LW+ + Sbjct: 94 YFKGCIDTLQRSDEEAQIQLWIKQ 117 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 55 VVKHTMLDVGTPKMVANS 108 V+K + LD+ T KM+ S Sbjct: 490 VIKSSFLDINTWKMLVKS 507 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,727 Number of Sequences: 336 Number of extensions: 2767 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13201902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -