BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0641 (561 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38622| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_3744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_38622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3824 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 401 LGVIRLSLKSQPKCNANCLRPRI 469 L + LSL S PKC+A C+R ++ Sbjct: 82 LALRSLSLVSPPKCSAGCIRRQV 104 >SB_3744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 341 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +3 Query: 81 DTIKGRMRKHKRESRAIACGPATSRSLQHTPHFII*YLQSAFR 209 D + +++K ESRA+ G + Q PH +I FR Sbjct: 169 DDVSEKLKKPLSESRAVHIGNPKTLEFQTNPHHVINLTYHVFR 211 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,887,153 Number of Sequences: 59808 Number of extensions: 411032 Number of successful extensions: 1086 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1084 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -