BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0637 (351 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29350| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) 26 9.9 >SB_29350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 25.8 bits (54), Expect = 9.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 271 TPLKHQTHYFHHKTS 315 TPL H+ H+ HH TS Sbjct: 101 TPLSHRYHHRHHHTS 115 >SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1769 Score = 25.8 bits (54), Expect = 9.9 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 280 KHQTHYFHHKTSFHF-SQLHDSF*K 351 K Q HY HKTS++ SQ H F K Sbjct: 57 KIQNHYALHKTSYNIHSQAHPGFLK 81 >SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 1024 Score = 25.8 bits (54), Expect = 9.9 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = +3 Query: 159 KTVNAQ*NGTKKNYYLSKYKTTYFHLLLITFKTLTLNYPT---KTPDPL 296 KT A N K+Y+ Y++ YF LLI ++T P K DP+ Sbjct: 88 KTAKAAQNIKVKSYF-RYYESNYFMFLLIVYRTEKKQNPVQDKKQTDPI 135 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,143,833 Number of Sequences: 59808 Number of extensions: 82697 Number of successful extensions: 164 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 535585339 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -