BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0636 (524 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 3.3 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 5.8 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 7.7 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 3.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -1 Query: 176 FHFWRPPP 153 F+FW PPP Sbjct: 1161 FNFWNPPP 1168 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 Query: 403 MKENFVICIESLHL 444 +KEN V C E++H+ Sbjct: 383 LKENTVTCQEAMHM 396 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -2 Query: 304 RPELWTPNGRSCTCTVQRVFSTEQWIIFERFILY 203 RP+ + N +S T + + W+ ++ ILY Sbjct: 120 RPDSFFKNAKSVTFQTMTIPNHYLWLYKDKTILY 153 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,897 Number of Sequences: 438 Number of extensions: 3323 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14722920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -