BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0635 (631 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 43 2e-04 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 43 2e-04 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 42 5e-04 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 41 7e-04 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 41 0.001 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 41 0.001 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 41 0.001 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 41 0.001 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 41 0.001 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 41 0.001 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 41 0.001 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 41 0.001 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 41 0.001 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 41 0.001 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 41 0.001 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 41 0.001 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) 39 0.003 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.083 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_19991| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_4076| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) 32 0.33 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) 32 0.33 SB_636| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 32 0.44 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 31 0.58 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_35116| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) 31 0.58 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_19471| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_15159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_9727| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_1896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_1570| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 31 0.77 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 31 0.77 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 31 0.77 SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_6663| Best HMM Match : DUF1502 (HMM E-Value=5.7) 31 0.77 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) 31 1.0 SB_31113| Best HMM Match : Herpes_U15 (HMM E-Value=8) 31 1.0 SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_15133| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3) 31 1.0 SB_7672| Best HMM Match : 7tm_1 (HMM E-Value=0.48) 31 1.0 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 30 1.3 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 30 1.3 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 30 1.3 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 30 1.3 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 30 1.3 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 30 1.3 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 30 1.3 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 30 1.3 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41525| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 30 1.3 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 30 1.3 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 30 1.3 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31194| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 30 1.3 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 30 1.3 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) 30 1.3 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 30 1.3 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 30 1.3 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 30 1.3 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 30 1.3 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 30 1.3 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_16406| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 30 1.3 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 30 1.3 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 30 1.3 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 30 1.3 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 30 1.3 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 30 1.3 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 30 1.3 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_2493| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 30 1.3 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 30 1.3 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 30 1.3 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53203| Best HMM Match : UCR_TM (HMM E-Value=5.1) 30 1.3 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 30 1.3 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 30 1.3 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49997| Best HMM Match : UCR_TM (HMM E-Value=1.1) 30 1.3 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 30 1.3 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 30 1.3 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 30 1.3 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 30 1.3 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46741| Best HMM Match : UCR_TM (HMM E-Value=5.1) 30 1.3 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 30 1.3 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 30 1.3 SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45316| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44324| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 30 1.3 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40405| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 30 1.3 SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37721| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36577| Best HMM Match : CC (HMM E-Value=7.9) 30 1.3 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36260| Best HMM Match : CAF1 (HMM E-Value=0) 30 1.3 SB_35731| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34588| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34052| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33852| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 30 1.3 SB_33774| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33605| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33484| Best HMM Match : UCR_TM (HMM E-Value=5.1) 30 1.3 SB_33361| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33060| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32479| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31495| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30447| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30018| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29984| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28658| Best HMM Match : I-set (HMM E-Value=1.5) 30 1.3 SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28406| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28209| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAAD 86 STA AAALELVDPPGCRNS AAD Sbjct: 6 STAVAAALELVDPPGCRNSIAAD 28 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/39 (58%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAADPFF*I-NIY*QSRHVN 131 STA AAALELVDPPGCRNS A I ++Y + VN Sbjct: 6 STAVAAALELVDPPGCRNSMVASELMEIYSMYNNDKDVN 44 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAADPFF 95 STA AAALELVDPPGCRNS D + Sbjct: 6 STAVAAALELVDPPGCRNSITKDKMY 31 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/53 (49%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAA---ADPFF*INIY*QSRHVNWSRDKFVKNLCY 167 STA AAALELVDPPGCRNS F ++I+ ++VN R K V Y Sbjct: 63 STAVAAALELVDPPGCRNSITVFHCHTKFRMSIHQAGKNVNKGRIKLVLIFLY 115 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAADP 89 STA AAALELVDPPGCRNS P Sbjct: 93 STAVAAALELVDPPGCRNSITGGP 116 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAADPFF*IN 104 STA AAALELVDPPGCRNS + F +N Sbjct: 6 STAVAAALELVDPPGCRNSIGQNGFTYMN 34 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAA 80 STA AAALELVDPPGCRNS A Sbjct: 6 STAVAAALELVDPPGCRNSIA 26 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAADPF 92 STA AAALELVDPPGCRNS ++PF Sbjct: 6 STAVAAALELVDPPGCRNS-MSNPF 29 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAA 80 STA AAALELVDPPGCRNS A Sbjct: 82 STAVAAALELVDPPGCRNSIA 102 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAA 83 STA AAALELVDPPGCRNS A Sbjct: 6 STAVAAALELVDPPGCRNSIQA 27 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAAD 86 STA AAALELVDPPGCRNS A+ Sbjct: 6 STAVAAALELVDPPGCRNSMNAN 28 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAADP 89 STA AAALELVDPPGCRNS P Sbjct: 26 STAVAAALELVDPPGCRNSMPDRP 49 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNSAAA 83 STA AAALELVDPPGCRNS ++ Sbjct: 650 STAVAAALELVDPPGCRNSISS 671 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 82 STAVAAALELVDPPGCRNS 100 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 23 STAVAAALELVDPPGCRNS 41 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 61 STAVAAALELVDPPGCRNS 79 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 23 STAVAAALELVDPPGCRNS 41 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 43 STAVAAALELVDPPGCRNS 61 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 93 STAVAAALELVDPPGCRNS 111 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 69 STAVAAALELVDPPGCRNS 87 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 18 STAXAAALELVDPPGCRNS 74 STA AAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) Length = 247 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 KKGSA EFLQPGGSTSSR AVE Sbjct: 118 KKGSALIEFLQPGGSTSSRAAATAVE 143 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 24 AXAAALELVDPPGCRNS 74 A AAALELVDPPGCRNS Sbjct: 8 AVAAALELVDPPGCRNS 24 >SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.083 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G+ A EFLQPGGSTSSR AVE Sbjct: 5 GAGAIEFLQPGGSTSSRAVVTAVE 28 >SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 KG EFLQPGGSTSSR AVE Sbjct: 5 KGEKTIEFLQPGGSTSSRAAATAVE 29 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 +GS EFLQPGGSTSSR AVE Sbjct: 37 RGSQPIEFLQPGGSTSSRAAATAVE 61 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 K G + EFLQPGGSTSSR AVE Sbjct: 16 KSGRSKIEFLQPGGSTSSRAAATAVE 41 >SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 KG+ EFLQPGGSTSSR AVE Sbjct: 16 KGTYLIEFLQPGGSTSSRAAATAVE 40 >SB_19991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -1 Query: 103 FI*KKGSAAAEFLQPGGSTSSRXXXXAVE 17 F+ K+ ++ EFLQPGGSTSSR AVE Sbjct: 40 FVGKRLTSIIEFLQPGGSTSSRAAATAVE 68 >SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 K SA EFLQPGGSTSSR AVE Sbjct: 24 KTRSAKIEFLQPGGSTSSRAAATAVE 49 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 AA EFLQPGGSTSSR AVE Sbjct: 2 AAIEFLQPGGSTSSRAAATAVE 23 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S A EFLQPGGSTSSR AVE Sbjct: 7 SVAIEFLQPGGSTSSRAAATAVE 29 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 K S EFLQPGGSTSSR AVE Sbjct: 16 KAASTVIEFLQPGGSTSSRAAATAVE 41 >SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 K A EFLQPGGSTSSR AVE Sbjct: 19 KNDALIEFLQPGGSTSSRAAATAVE 43 >SB_4076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 GS EFLQPGGSTSSR AVE Sbjct: 7 GSLLIEFLQPGGSTSSRAAATAVE 30 >SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.7 bits (71), Expect = 0.25 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 ++G + EFLQPGGSTSSR AVE Sbjct: 11 ERGVSMIEFLQPGGSTSSRAAATAVE 36 >SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.7 bits (71), Expect = 0.25 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G + EFLQPGGSTSSR AVE Sbjct: 7 GKSGLEFLQPGGSTSSRAAATAVE 30 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.33 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 +K + + EFLQPGGSTSSR AVE Sbjct: 16 RKHTLSIEFLQPGGSTSSRAAATAVE 41 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.3 bits (70), Expect = 0.33 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 K+ + EFLQPGGSTSSR AVE Sbjct: 20 KRSTQMIEFLQPGGSTSSRAAATAVE 45 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 32.3 bits (70), Expect = 0.33 Identities = 18/27 (66%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 94 KKGSAA-AEFLQPGGSTSSRXXXXAVE 17 +KGS EFLQPGGSTSSR AVE Sbjct: 90 RKGSTTHIEFLQPGGSTSSRAAATAVE 116 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.33 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G + EFLQPGGSTSSR AVE Sbjct: 7 GESRIEFLQPGGSTSSRAAATAVE 30 >SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) Length = 156 Score = 32.3 bits (70), Expect = 0.33 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 K S EFLQPGGSTSSR AVE Sbjct: 28 KASLDIEFLQPGGSTSSRAAATAVE 52 >SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.3 bits (70), Expect = 0.33 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S A EFLQPGGSTSSR AVE Sbjct: 18 SFAIEFLQPGGSTSSRAAATAVE 40 >SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) Length = 175 Score = 32.3 bits (70), Expect = 0.33 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 K + EFLQPGGSTSSR AVE Sbjct: 47 KAKGSIEFLQPGGSTSSRAAATAVE 71 >SB_636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.33 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G+ EFLQPGGSTSSR AVE Sbjct: 6 GTLTIEFLQPGGSTSSRAAATAVE 29 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.9 bits (69), Expect = 0.44 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 KG EFLQPGGSTSSR AVE Sbjct: 4 KGFYYIEFLQPGGSTSSRAAATAVE 28 >SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.44 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = -1 Query: 103 FI*KKGSAAAEFLQPGGSTSSRXXXXAVE 17 FI + EFLQPGGSTSSR AVE Sbjct: 11 FIVDSSGSIIEFLQPGGSTSSRAAATAVE 39 >SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) Length = 504 Score = 31.9 bits (69), Expect = 0.44 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = -1 Query: 106 IFI*KKGSAAAEFLQPGGSTSSRXXXXAVE 17 +FI + EFLQPGGSTSSR AVE Sbjct: 101 LFILRDNHLNIEFLQPGGSTSSRAAATAVE 130 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 31.9 bits (69), Expect = 0.44 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 +G EFLQPGGSTSSR AVE Sbjct: 50 EGQKLIEFLQPGGSTSSRAAATAVE 74 >SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.44 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G EFLQPGGSTSSR AVE Sbjct: 2 GQVIIEFLQPGGSTSSRAAATAVE 25 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.44 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 +A EFLQPGGSTSSR AVE Sbjct: 10 TACIEFLQPGGSTSSRAAATAVE 32 >SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.9 bits (69), Expect = 0.44 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 +K EFLQPGGSTSSR AVE Sbjct: 27 RKDEVLIEFLQPGGSTSSRAAATAVE 52 >SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.44 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 K S EFLQPGGSTSSR AVE Sbjct: 12 KDTSGIIEFLQPGGSTSSRAAATAVE 37 >SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.44 Identities = 18/29 (62%), Positives = 19/29 (65%) Frame = -1 Query: 103 FI*KKGSAAAEFLQPGGSTSSRXXXXAVE 17 FI K + EFLQPGGSTSSR AVE Sbjct: 2 FIDKLQNLDIEFLQPGGSTSSRAAATAVE 30 >SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.44 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A+ EFLQPGGSTSSR AVE Sbjct: 33 ASIEFLQPGGSTSSRAAATAVE 54 >SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.44 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G+ EFLQPGGSTSSR AVE Sbjct: 22 GTRLIEFLQPGGSTSSRAAATAVE 45 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 13 AIEFLQPGGSTSSRAAATAVE 33 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G + EFLQPGGSTSSR AVE Sbjct: 47 GFSRIEFLQPGGSTSSRAAATAVE 70 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 67 AGIEFLQPGGSTSSRAAATAVE 88 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 12 AIEFLQPGGSTSSRAAATAVE 32 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 22 AIEFLQPGGSTSSRAAATAVE 42 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 3 AIEFLQPGGSTSSRAAATAVE 23 >SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G EFLQPGGSTSSR AVE Sbjct: 11 GLCGIEFLQPGGSTSSRAAATAVE 34 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 147 AIEFLQPGGSTSSRAAATAVE 167 >SB_35116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 28 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 2 AIEFLQPGGSTSSRAAATAVE 22 >SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 54 AIEFLQPGGSTSSRAAATAVE 74 >SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) Length = 177 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 151 AIEFLQPGGSTSSRAAATAVE 171 >SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 35 STGIEFLQPGGSTSSRAAATAVE 57 >SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 6 AIEFLQPGGSTSSRAAATAVE 26 >SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 +A EFLQPGGSTSSR AVE Sbjct: 19 NAIIEFLQPGGSTSSRAAATAVE 41 >SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 41 AGIEFLQPGGSTSSRAAATAVE 62 >SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 60 AIEFLQPGGSTSSRAAATAVE 80 >SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.5 bits (68), Expect = 0.58 Identities = 18/30 (60%), Positives = 19/30 (63%) Frame = -1 Query: 106 IFI*KKGSAAAEFLQPGGSTSSRXXXXAVE 17 +FI S EFLQPGGSTSSR AVE Sbjct: 43 LFIENIHSLYIEFLQPGGSTSSRAAATAVE 72 >SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.5 bits (68), Expect = 0.58 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 KKG EFLQPGGSTSSR AVE Sbjct: 21 KKG-CLIEFLQPGGSTSSRAAATAVE 45 >SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.5 bits (68), Expect = 0.58 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 K S EFLQPGGSTSSR AVE Sbjct: 7 KAKSLRIEFLQPGGSTSSRAAATAVE 32 >SB_19471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 7 AIEFLQPGGSTSSRAAATAVE 27 >SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 38 AIEFLQPGGSTSSRAAATAVE 58 >SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G + EFLQPGGSTSSR AVE Sbjct: 22 GVSMIEFLQPGGSTSSRAAATAVE 45 >SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G+ EFLQPGGSTSSR AVE Sbjct: 14 GNKDIEFLQPGGSTSSRAAATAVE 37 >SB_15159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 K + EFLQPGGSTSSR AVE Sbjct: 15 KNGSDIEFLQPGGSTSSRAAATAVE 39 >SB_9727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 10 SCCIEFLQPGGSTSSRAAATAVE 32 >SB_1896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 4 AIEFLQPGGSTSSRAAATAVE 24 >SB_1570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 AAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 3 AIEFLQPGGSTSSRAAATAVE 23 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G + EFLQPGGSTSSR AVE Sbjct: 32 GLSNIEFLQPGGSTSSRAAATAVE 55 >SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G + EFLQPGGSTSSR AVE Sbjct: 2 GLSFIEFLQPGGSTSSRAAATAVE 25 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 44 AQIEFLQPGGSTSSRAAATAVE 65 >SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) Length = 156 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 31 AIIEFLQPGGSTSSRAAATAVE 52 >SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 7 STKIEFLQPGGSTSSRAAATAVE 29 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G EFLQPGGSTSSR AVE Sbjct: 22 GKRYIEFLQPGGSTSSRAAATAVE 45 >SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 8 AMIEFLQPGGSTSSRAAATAVE 29 >SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 37 SVIIEFLQPGGSTSSRAAATAVE 59 >SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G EFLQPGGSTSSR AVE Sbjct: 4 GPIIIEFLQPGGSTSSRAAATAVE 27 >SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 + S EFLQPGGSTSSR AVE Sbjct: 21 QSSSLQIEFLQPGGSTSSRAAATAVE 46 >SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.1 bits (67), Expect = 0.77 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 K S EFLQPGGSTSSR AVE Sbjct: 2 KPFSKPIEFLQPGGSTSSRAAATAVE 27 >SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S+ EFLQPGGSTSSR AVE Sbjct: 17 SSDIEFLQPGGSTSSRAAATAVE 39 >SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 52 AKIEFLQPGGSTSSRAAATAVE 73 >SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G EFLQPGGSTSSR AVE Sbjct: 29 GRQKIEFLQPGGSTSSRAAATAVE 52 >SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1153 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 362 SIVIEFLQPGGSTSSRAAATAVE 384 >SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 +G EFLQPGGSTSSR AVE Sbjct: 12 EGPKHIEFLQPGGSTSSRAAATAVE 36 >SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 K + EFLQPGGSTSSR AVE Sbjct: 22 KRCSCIEFLQPGGSTSSRAAATAVE 46 >SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) Length = 149 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 24 ARIEFLQPGGSTSSRAAATAVE 45 >SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 3 ALIEFLQPGGSTSSRAAATAVE 24 >SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G EFLQPGGSTSSR AVE Sbjct: 2 GPFTIEFLQPGGSTSSRAAATAVE 25 >SB_6663| Best HMM Match : DUF1502 (HMM E-Value=5.7) Length = 189 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 +K EFLQPGGSTSSR AVE Sbjct: 60 RKRPMGIEFLQPGGSTSSRAAATAVE 85 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 ++ EFLQPGGSTSSR AVE Sbjct: 24 SSIEFLQPGGSTSSRAAATAVE 45 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 K EFLQPGGSTSSR AVE Sbjct: 19 KAYPCIEFLQPGGSTSSRAAATAVE 43 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 22 SPMIEFLQPGGSTSSRAAATAVE 44 >SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 21 SRLIEFLQPGGSTSSRAAATAVE 43 >SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 ++ EFLQPGGSTSSR AVE Sbjct: 12 SSIEFLQPGGSTSSRAAATAVE 33 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 ++ EFLQPGGSTSSR AVE Sbjct: 15 SSIEFLQPGGSTSSRAAATAVE 36 >SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 ++ EFLQPGGSTSSR AVE Sbjct: 61 SSIEFLQPGGSTSSRAAATAVE 82 >SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 1.0 Identities = 18/28 (64%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -1 Query: 94 KKGSAAA--EFLQPGGSTSSRXXXXAVE 17 K+G A EFLQPGGSTSSR AVE Sbjct: 3 KEGHAGKMIEFLQPGGSTSSRAAATAVE 30 >SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 +K + EFLQPGGSTSSR AVE Sbjct: 50 EKHFRSIEFLQPGGSTSSRAAATAVE 75 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 K+ + EFLQPGGSTSSR AVE Sbjct: 11 KEIKSRIEFLQPGGSTSSRAAATAVE 36 >SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 29 SVNIEFLQPGGSTSSRAAATAVE 51 >SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 41 ANIEFLQPGGSTSSRAAATAVE 62 >SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 ++ EFLQPGGSTSSR AVE Sbjct: 49 SSIEFLQPGGSTSSRAAATAVE 70 >SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 ++ EFLQPGGSTSSR AVE Sbjct: 20 SSIEFLQPGGSTSSRAAATAVE 41 >SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 GSAAAEFLQPGGSTSSRXXXXAVE 17 G EFLQPGGSTSSR AVE Sbjct: 2 GRNPIEFLQPGGSTSSRAAATAVE 25 >SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 K + EFLQPGGSTSSR AVE Sbjct: 29 KKHKSIEFLQPGGSTSSRAAATAVE 53 >SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) Length = 187 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = -1 Query: 94 KKGSAAAEFLQPGGSTSSRXXXXAVE 17 KK EFLQPGGSTSSR AVE Sbjct: 58 KKLFFCIEFLQPGGSTSSRAAATAVE 83 >SB_31113| Best HMM Match : Herpes_U15 (HMM E-Value=8) Length = 133 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 A EFLQPGGSTSSR AVE Sbjct: 44 AYIEFLQPGGSTSSRAAATAVE 65 >SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 14 SNCIEFLQPGGSTSSRAAATAVE 36 >SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 ++ EFLQPGGSTSSR AVE Sbjct: 195 TSGIEFLQPGGSTSSRAAATAVE 217 >SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 82 AAAEFLQPGGSTSSRXXXXAVE 17 ++ EFLQPGGSTSSR AVE Sbjct: 10 SSIEFLQPGGSTSSRAAATAVE 31 >SB_15133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 K S EFLQPGGSTSSR AVE Sbjct: 2 KLSINIEFLQPGGSTSSRAAATAVE 26 >SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 91 KGSAAAEFLQPGGSTSSRXXXXAVE 17 +G EFLQPGGSTSSR AVE Sbjct: 30 QGYPNIEFLQPGGSTSSRAAATAVE 54 >SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3) Length = 207 Score = 30.7 bits (66), Expect = 1.0 Identities = 19/29 (65%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = -1 Query: 94 KKGSAAA---EFLQPGGSTSSRXXXXAVE 17 K+ S AA EFLQPGGSTSSR AVE Sbjct: 76 KRRSPAARQIEFLQPGGSTSSRAAATAVE 104 >SB_7672| Best HMM Match : 7tm_1 (HMM E-Value=0.48) Length = 242 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 SAAAEFLQPGGSTSSRXXXXAVE 17 S EFLQPGGSTSSR AVE Sbjct: 117 SMMIEFLQPGGSTSSRAAATAVE 139 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 4 EFLQPGGSTSSRAAATAVE 22 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 31 EFLQPGGSTSSRAAATAVE 49 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 7 EFLQPGGSTSSRAAATAVE 25 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 39 EFLQPGGSTSSRAAATAVE 57 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 22 EFLQPGGSTSSRAAATAVE 40 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 38 EFLQPGGSTSSRAAATAVE 56 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 26 EFLQPGGSTSSRAAATAVE 44 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 72 EFLQPGGSTSSRAAATAVE 90 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 112 EFLQPGGSTSSRAAATAVE 130 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 29 EFLQPGGSTSSRAAATAVE 47 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 3 EFLQPGGSTSSRAAATAVE 21 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 42 EFLQPGGSTSSRAAATAVE 60 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 4 EFLQPGGSTSSRAAATAVE 22 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 25 EFLQPGGSTSSRAAATAVE 43 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 38 EFLQPGGSTSSRAAATAVE 56 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 19 EFLQPGGSTSSRAAATAVE 37 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 6 EFLQPGGSTSSRAAATAVE 24 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 5 EFLQPGGSTSSRAAATAVE 23 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 24 EFLQPGGSTSSRAAATAVE 42 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 80 EFLQPGGSTSSRAAATAVE 98 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 18 EFLQPGGSTSSRAAATAVE 36 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 130 EFLQPGGSTSSRAAATAVE 148 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 21 EFLQPGGSTSSRAAATAVE 39 >SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) Length = 146 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 25 EFLQPGGSTSSRAAATAVE 43 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 3 EFLQPGGSTSSRAAATAVE 21 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 10 EFLQPGGSTSSRAAATAVE 28 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 59 EFLQPGGSTSSRAAATAVE 77 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 78 EFLQPGGSTSSRAAATAVE 96 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 39 EFLQPGGSTSSRAVATAVE 57 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 5 EFLQPGGSTSSRAAATAVE 23 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 64 EFLQPGGSTSSRAAATAVE 82 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 11 EFLQPGGSTSSRAAATAVE 29 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 12 EFLQPGGSTSSRAAATAVE 30 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 7 EFLQPGGSTSSRAAATAVE 25 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 116 EFLQPGGSTSSRAAATAVE 134 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 26 EFLQPGGSTSSRAAATAVE 44 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 7 EFLQPGGSTSSRAAATAVE 25 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 11 EFLQPGGSTSSRAAATAVE 29 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 19 EFLQPGGSTSSRAAATAVE 37 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 95 EFLQPGGSTSSRAAATAVE 113 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 52 EFLQPGGSTSSRAAATAVE 70 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) Length = 499 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 377 EFLQPGGSTSSRAAATAVE 395 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 58 EFLQPGGSTSSRAAATAVE 76 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 432 EFLQPGGSTSSRAAATAVE 450 >SB_41525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 44 EFLQPGGSTSSRAAATAVE 62 >SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 8 EFLQPGGSTSSRAAATAVE 26 >SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 3 EFLQPGGSTSSRAAATAVE 21 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 71 EFLQPGGSTSSRAAATAVE 89 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_38022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 166 EFLQPGGSTSSRAAATAVE 184 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 36 EFLQPGGSTSSRAAATAVE 54 >SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 58 EFLQPGGSTSSRAAATAVE 76 >SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 16 EFLQPGGSTSSRAAATAVE 34 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 7 EFLQPGGSTSSRAAATAVE 25 >SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 39 EFLQPGGSTSSRAAATAVE 57 >SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 41 EFLQPGGSTSSRAAATAVE 59 >SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 103 EFLQPGGSTSSRAAATAVE 121 >SB_34190| Best HMM Match : MAM (HMM E-Value=0) Length = 384 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 46 EFLQPGGSTSSRAAATAVE 64 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 22 EFLQPGGSTSSRAAATAVE 40 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) Length = 331 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 209 EFLQPGGSTSSRAAATAVE 227 >SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) Length = 148 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 26 EFLQPGGSTSSRAAATAVE 44 >SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 79 EFLQPGGSTSSRAAATAVE 97 >SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 14 EFLQPGGSTSSRAAATAVE 32 >SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 25 EFLQPGGSTSSRAAATAVE 43 >SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 14 EFLQPGGSTSSRAAATAVE 32 >SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 6 EFLQPGGSTSSRAAATAVE 24 >SB_31194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 84 EFLQPGGSTSSRAAATAVE 102 >SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 43 EFLQPGGSTSSRAAATAVE 61 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 46 EFLQPGGSTSSRAAATAVE 64 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 31 EFLQPGGSTSSRAAATAVE 49 >SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) Length = 163 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 41 EFLQPGGSTSSRAAATAVE 59 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 38 EFLQPGGSTSSRAAATAVE 56 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 82 EFLQPGGSTSSRAAATAVE 100 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) Length = 213 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 141 EFLQPGGSTSSRAAATAVE 159 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 34 EFLQPGGSTSSRAAATAVE 52 >SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 EFLQPGGSTSSRXXXXAVE 17 EFLQPGGSTSSR AVE Sbjct: 53 EFLQPGGSTSSRAAATAVE 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,398,904 Number of Sequences: 59808 Number of extensions: 364031 Number of successful extensions: 2806 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2806 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -