BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0635 (631 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L16685-6|ABD63199.1| 1047|Caenorhabditis elegans Trp (transient ... 29 2.7 L16685-5|AAA28167.3| 1027|Caenorhabditis elegans Trp (transient ... 29 2.7 AJ276027-1|CAC81654.1| 1027|Caenorhabditis elegans TRP homologou... 29 2.7 >L16685-6|ABD63199.1| 1047|Caenorhabditis elegans Trp (transient receptor potential)channel family protein 1, isoform b protein. Length = 1047 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 289 IPPKEDIYMINIMYFPALWMSIKYMYVYNKN 197 + PK IY++N ++ W+ KY Y N+N Sbjct: 721 VTPKSLIYVMNCLFNTVRWLLGKYTYQKNRN 751 >L16685-5|AAA28167.3| 1027|Caenorhabditis elegans Trp (transient receptor potential)channel family protein 1, isoform a protein. Length = 1027 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 289 IPPKEDIYMINIMYFPALWMSIKYMYVYNKN 197 + PK IY++N ++ W+ KY Y N+N Sbjct: 701 VTPKSLIYVMNCLFNTVRWLLGKYTYQKNRN 731 >AJ276027-1|CAC81654.1| 1027|Caenorhabditis elegans TRP homologous cation channel proteinprotein. Length = 1027 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 289 IPPKEDIYMINIMYFPALWMSIKYMYVYNKN 197 + PK IY++N ++ W+ KY Y N+N Sbjct: 701 VTPKSLIYVMNCLFNTVRWLLGKYTYQKNRN 731 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,774,993 Number of Sequences: 27780 Number of extensions: 276564 Number of successful extensions: 588 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1385109898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -