BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0634 (438 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 27 0.12 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 25 0.37 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 1.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 1.1 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 1.5 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 2.6 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 3.4 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 4.5 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 4.5 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 4.5 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 4.5 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 5.9 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 5.9 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 5.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 5.9 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 5.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 5.9 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 5.9 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 5.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 5.9 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 7.9 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 7.9 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 26.6 bits (56), Expect = 0.12 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -1 Query: 390 IMTSASMRCLCRPCS 346 ++T A + C+CRPC+ Sbjct: 105 VITKAPLECMCRPCT 119 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.0 bits (52), Expect = 0.37 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +1 Query: 109 QAPCWCGGATRRTNRQDVSSGLSRWWRCPEV 201 Q W G N D + G R+WR P V Sbjct: 258 QTKGWDGSNMVEGNESDHNDGRLRYWRTPSV 288 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 1.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 378 QMSLSRHRTAHKLHHLL 428 ++ LSRH T+H+L LL Sbjct: 1450 ELQLSRHATSHELKGLL 1466 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.4 bits (48), Expect = 1.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 378 QMSLSRHRTAHKLHHLL 428 ++ LSRH T+H+L LL Sbjct: 1446 ELQLSRHATSHELKGLL 1462 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 209 RHSLTVQVVITPLLLDVGWSPAEIPVPPVTP 301 +HS + P + +G +P P PP TP Sbjct: 443 QHSTPLAHSSYPAAIQIGHTPHHHPHPPETP 473 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 2.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 397 CLDNDICKYEMF 362 C D+DI KY+MF Sbjct: 192 CTDSDIEKYKMF 203 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 3.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 325 QFQIPNKRGSYRGHGYFS 272 ++ P+K +YR HGY S Sbjct: 605 RYAAPHKAFTYRMHGYAS 622 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 117 QIPVPVPVPVYCGNFP--PRP 135 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 121 QIPVPVPVPVYCGNFP--PRP 139 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 121 QIPVPVPVPVYCGNFP--PRP 139 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 4.5 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKPQALL-QGLHKHLILADVI 388 +IP PP P L L P A+ Q L K DV+ Sbjct: 43 KIPGPPALPLIGNALDLFGSPDAMFSQVLKKAENFKDVV 81 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 115 QIPVPVPVPIYCGNFP--PRP 133 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 115 QIPVPVPVPIYCGNFP--PRP 133 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 126 QIPVPVPVPIYCGNFP--PRP 144 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 332 QIPVPVPVPIYCGNFP--PRP 350 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 343 QIPVPVPVPIYCGNFP--PRP 361 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 361 QIPVPVPVPIYCGNFP--PRP 379 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 335 QIPVPVPVPIYYGNFP--PRP 353 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 353 QIPVPVPVPIYCGNFP--PRP 371 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVPKP 337 +IPVP P + GN P+P Sbjct: 363 QIPVPVPVPIYCGNFP--PRP 381 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVP 331 +IPVP P + GN P Sbjct: 118 QIPVPVPVPIYCGNFPSRP 136 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVP 331 +IPVP P + GN P Sbjct: 118 QIPVPVPVPIYCGNFPSRP 136 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVP 331 +IPVP P + GN P Sbjct: 118 QIPVPVPVPIYCGNFPSRP 136 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVP 331 +IPVP P + GN P Sbjct: 118 QIPVPVPVPIYCGNFPSRP 136 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVP 331 +IPVP P + GN P Sbjct: 118 QIPVPVPVPIYCGNFPSRP 136 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVP 331 +IPVP P + GN P Sbjct: 118 QIPVPVPVPIYCGNFPSRP 136 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVP 331 +IPVP P + GN P Sbjct: 118 QIPVPVPVPIYCGNFPSRP 136 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 275 EIPVPPVTPAFVGNLKLVP 331 +IPVP P + GN P Sbjct: 121 QIPVPVPVPIYCGNFPSRP 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,785 Number of Sequences: 438 Number of extensions: 3423 Number of successful extensions: 31 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11327868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -