BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0634 (438 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)... 45 3e-05 At5g03340.1 68418.m00286 cell division cycle protein 48, putativ... 42 2e-04 At3g53230.1 68416.m05865 cell division cycle protein 48, putativ... 39 0.002 At5g64750.1 68418.m08142 AP2 domain-containing transcription fac... 29 1.4 At3g26430.1 68416.m03294 GDSL-motif lipase/hydrolase family prot... 29 1.4 At2g31810.3 68415.m03885 acetolactate synthase small subunit, pu... 29 1.8 At2g31810.2 68415.m03884 acetolactate synthase small subunit, pu... 29 1.8 At2g31810.1 68415.m03883 acetolactate synthase small subunit, pu... 29 1.8 At1g02300.1 68414.m00173 cathepsin B-like cysteine protease, put... 29 1.8 At3g63100.1 68416.m07087 glycine-rich protein 28 2.4 At3g59700.1 68416.m06661 lectin protein kinase, putative similar... 28 2.4 At3g66654.3 68416.m00779 peptidyl-prolyl cis-trans isomerase cyc... 27 5.5 At3g66654.2 68416.m00778 peptidyl-prolyl cis-trans isomerase cyc... 27 5.5 At3g66654.1 68416.m00777 peptidyl-prolyl cis-trans isomerase cyc... 27 5.5 At3g55850.2 68416.m06206 amidohydrolase family protein weak simi... 27 5.5 At3g55850.1 68416.m06205 amidohydrolase family protein weak simi... 27 5.5 At3g59750.1 68416.m06666 receptor lectin kinase, putative simila... 27 7.3 At1g26170.1 68414.m03194 importin beta-2 subunit family protein ... 27 7.3 At5g37880.1 68418.m04564 hypothetical protein predicted protein,... 26 9.7 At4g03230.1 68417.m00442 S-locus lectin protein kinase family pr... 26 9.7 At3g02130.1 68416.m00180 leucine-rich repeat transmembrane prote... 26 9.7 At1g45249.2 68414.m05192 ABA-responsive element-binding protein ... 26 9.7 >At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A) (CDC48) identical to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana} Length = 809 Score = 44.8 bits (101), Expect = 3e-05 Identities = 24/57 (42%), Positives = 29/57 (50%) Frame = -3 Query: 391 DNDICKYEMFVQTLQQSLWFWNQFQIPNKRGSYRGHGYFSG*PAHVQEEGGDDDLYS 221 D DI KY+ F QTLQQS F ++F+ N GS G G DDDLY+ Sbjct: 753 DADIRKYQAFAQTLQQSRGFGSEFRFENSAGSGATTGVADPFATSAAAAGDDDDLYN 809 >At5g03340.1 68418.m00286 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; supporting cDNA gi|26449351|dbj|AK117125.1| Length = 810 Score = 41.5 bits (93), Expect = 2e-04 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -3 Query: 391 DNDICKYEMFVQTLQQSLWFWNQFQIPNKRGSYRGHGYFSG*P-AHVQEEGGDDDLYS 221 D DI KY+ F QTLQQS F ++F+ + G R G + P A DDDLYS Sbjct: 753 DADIRKYQAFAQTLQQSRGFGSEFRFDSTAGVGRTTGVAAADPFATSAAAADDDDLYS 810 >At3g53230.1 68416.m05865 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain Length = 815 Score = 38.7 bits (86), Expect = 0.002 Identities = 26/64 (40%), Positives = 33/64 (51%), Gaps = 7/64 (10%) Frame = -3 Query: 391 DNDICKYEMFVQTLQQSLWFWNQFQIPN----KRGSYRGHGYFSG*PAHVQEEGG---DD 233 D DI KY+ F QTLQQS F ++F+ P+ G++ G G GG DD Sbjct: 752 DADIRKYQAFAQTLQQSRGFGSEFRFPDAPTGTTGAFPGAAATVGGVDPFATSGGAADDD 811 Query: 232 DLYS 221 DLYS Sbjct: 812 DLYS 815 >At5g64750.1 68418.m08142 AP2 domain-containing transcription factor, putative contains similarity to transcription factor Length = 391 Score = 29.1 bits (62), Expect = 1.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -1 Query: 348 SRACGFGTNFRFPTNAGVTGGTGISAGDQPTSRRRGV 238 S G G + + T A + T +GDQP R RGV Sbjct: 152 SNMSGPGPTYEYTTTATASSETSSFSGDQPRRRYRGV 188 >At3g26430.1 68416.m03294 GDSL-motif lipase/hydrolase family protein similar to early nodulin ENOD8 [Medicago sativa] GI:304037; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 380 Score = 29.1 bits (62), Expect = 1.4 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 366 CLCRP--CSRACGFGTNFRFPTNAGVTGGTGISAGDQP 259 CL P CS +C F F F + TGG S G P Sbjct: 16 CLIHPRACSPSCNFPAIFNFGDSNSDTGGLSASFGQAP 53 >At2g31810.3 68415.m03885 acetolactate synthase small subunit, putative similar to gi:5931761 from Nicotiana plumbaginifolia Length = 469 Score = 28.7 bits (61), Expect = 1.8 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 5/88 (5%) Frame = -1 Query: 396 VLIMTSASMRCL---CRPCSRACGFGTNFRFPTNAGVTGGTGISAGDQPTSRRRGVMTTC 226 + + +S S+RCL C S A T FP G GD+ R G + + Sbjct: 4 ISVSSSPSIRCLRSACSDSSPALVSSTRVSFPAKISYLSGISSHRGDEMGKRMEGFVRSV 63 Query: 225 TVKLCLA--RDLGASPPSR*TRTNVLSV 148 K+ A + ++ P R + +SV Sbjct: 64 DGKISDASFSEASSATPKSKVRKHTISV 91 >At2g31810.2 68415.m03884 acetolactate synthase small subunit, putative similar to gi:5931761 from Nicotiana plumbaginifolia Length = 492 Score = 28.7 bits (61), Expect = 1.8 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 5/88 (5%) Frame = -1 Query: 396 VLIMTSASMRCL---CRPCSRACGFGTNFRFPTNAGVTGGTGISAGDQPTSRRRGVMTTC 226 + + +S S+RCL C S A T FP G GD+ R G + + Sbjct: 4 ISVSSSPSIRCLRSACSDSSPALVSSTRVSFPAKISYLSGISSHRGDEMGKRMEGFVRSV 63 Query: 225 TVKLCLA--RDLGASPPSR*TRTNVLSV 148 K+ A + ++ P R + +SV Sbjct: 64 DGKISDASFSEASSATPKSKVRKHTISV 91 >At2g31810.1 68415.m03883 acetolactate synthase small subunit, putative similar to gi:5931761 from Nicotiana plumbaginifolia Length = 491 Score = 28.7 bits (61), Expect = 1.8 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 5/88 (5%) Frame = -1 Query: 396 VLIMTSASMRCL---CRPCSRACGFGTNFRFPTNAGVTGGTGISAGDQPTSRRRGVMTTC 226 + + +S S+RCL C S A T FP G GD+ R G + + Sbjct: 4 ISVSSSPSIRCLRSACSDSSPALVSSTRVSFPAKISYLSGISSHRGDEMGKRMEGFVRSV 63 Query: 225 TVKLCLA--RDLGASPPSR*TRTNVLSV 148 K+ A + ++ P R + +SV Sbjct: 64 DGKISDASFSEASSATPKSKVRKHTISV 91 >At1g02300.1 68414.m00173 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase GI:609175 from [Nicotiana rustica] Length = 379 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 420 DEVCVPFCVLIMTSASMRCLCRPCSRACGFGTNFRFPTNA 301 D C+ + + + SA+ C C CGFG N FP A Sbjct: 162 DRFCIKYNLNVSLSANDVIAC--CGLLCGFGCNGGFPMGA 199 >At3g63100.1 68416.m07087 glycine-rich protein Length = 199 Score = 28.3 bits (60), Expect = 2.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 310 NKRGSYRGHGYFSG*PAHVQEEG 242 ++RG RGHG+ G HVQE G Sbjct: 133 HRRGRGRGHGHGRGRGGHVQEAG 155 >At3g59700.1 68416.m06661 lectin protein kinase, putative similar to receptor lectin kinase 3 [Arabidopsis thaliana] gi|4100060|gb|AAD00733 Length = 661 Score = 28.3 bits (60), Expect = 2.4 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 251 LDVGWSPAEIPVPPVTPAFVGNLKLVP 331 L+V PAEIPVPP+ P N L P Sbjct: 197 LNVTLFPAEIPVPPLKPLLSLNRDLSP 223 >At3g66654.3 68416.m00779 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein contains Pfam domain, PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 236 Score = 27.1 bits (57), Expect = 5.5 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 227 QVVITPLLLDVGWSPAEIPVPPVTP--AFVGNLKLVPKPQALLQGLHKH 367 Q VI L+ G SP+ IPV T G L + PK +A + G K+ Sbjct: 123 QRVIKNYLVQAGHSPSSIPVEEWTAKGKLRGRLHIGPKHEAFMLGTPKN 171 >At3g66654.2 68416.m00778 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein contains Pfam domain, PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 236 Score = 27.1 bits (57), Expect = 5.5 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 227 QVVITPLLLDVGWSPAEIPVPPVTP--AFVGNLKLVPKPQALLQGLHKH 367 Q VI L+ G SP+ IPV T G L + PK +A + G K+ Sbjct: 123 QRVIKNYLVQAGHSPSSIPVEEWTAKGKLRGRLHIGPKHEAFMLGTPKN 171 >At3g66654.1 68416.m00777 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein contains Pfam domain, PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 236 Score = 27.1 bits (57), Expect = 5.5 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 227 QVVITPLLLDVGWSPAEIPVPPVTP--AFVGNLKLVPKPQALLQGLHKH 367 Q VI L+ G SP+ IPV T G L + PK +A + G K+ Sbjct: 123 QRVIKNYLVQAGHSPSSIPVEEWTAKGKLRGRLHIGPKHEAFMLGTPKN 171 >At3g55850.2 68416.m06206 amidohydrolase family protein weak similarity to SP|Q06555 Exoenzymes regulatory protein aepA precursor {Erwinia carotovora}; contains Pfam profile PF01979: Amidohydrolase family Length = 583 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 218 LTVQVVITPLLLDVGWSPAEIPVPP 292 L + V PLL D+ WS + P PP Sbjct: 20 LLISVAYLPLLNDLYWSTLKSPTPP 44 >At3g55850.1 68416.m06205 amidohydrolase family protein weak similarity to SP|Q06555 Exoenzymes regulatory protein aepA precursor {Erwinia carotovora}; contains Pfam profile PF01979: Amidohydrolase family Length = 576 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 218 LTVQVVITPLLLDVGWSPAEIPVPP 292 L + V PLL D+ WS + P PP Sbjct: 13 LLISVAYLPLLNDLYWSTLKSPTPP 37 >At3g59750.1 68416.m06666 receptor lectin kinase, putative similar to receptor lectin kinase 3 [Arabidopsis thaliana] gi|4100060|gb|AAD00733 Length = 626 Score = 26.6 bits (56), Expect = 7.3 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 251 LDVGWSPAEIPVPPVTPAFVGNLKLVP 331 L+V PAEIPVPP P N L P Sbjct: 161 LNVTLFPAEIPVPPRKPLLSLNRDLSP 187 >At1g26170.1 68414.m03194 importin beta-2 subunit family protein similar to Importin9 isoform 1 [Mus musculus] GI:15186756; contains Pfam profile PF03810: Importin-beta N-terminal domain Length = 931 Score = 26.6 bits (56), Expect = 7.3 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 149 TDRTLVLVYRDGGDAPRSRARHSLTVQVVITPLLLDV 259 TD TLVLV A ++ S +++ +I+P++L+V Sbjct: 534 TDETLVLVLETLQQAIKAGHEASASIESIISPVILNV 570 >At5g37880.1 68418.m04564 hypothetical protein predicted protein, Arabidopsis thaliana Length = 154 Score = 26.2 bits (55), Expect = 9.7 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +1 Query: 118 CWCGGATRRTNRQDVSSGLSRWWRCPEVAS 207 CWCG + S+ R++RC A+ Sbjct: 27 CWCGATISALMSKSASNPYRRYYRCAYAAT 56 >At4g03230.1 68417.m00442 S-locus lectin protein kinase family protein contains Pfam domins, PF00069: Protein kinase domain, PF00954: S-locus glycoprotein family and PF01453: Lectin (probable mannose binding) Length = 852 Score = 26.2 bits (55), Expect = 9.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -2 Query: 158 SCLFVLRVAPPHQHGAWPRPVHVCDSDADIGRVV 57 S +F+ R + G+ PR VH+CDS+ I ++ Sbjct: 469 SYVFLQRRKVNKELGSIPRGVHLCDSERHIKELI 502 >At3g02130.1 68416.m00180 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: Eukaryotic protein kinase domain Length = 985 Score = 26.2 bits (55), Expect = 9.7 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +2 Query: 104 GARRH---VGVVGRHAGQTDRTLVLVYRDGGDAPRSRARHSLTVQVVITPLLLDV 259 G RH V ++G HA +T+ LV Y GG+ + S V+ + LD+ Sbjct: 757 GRLRHPNLVTLIGYHASETEMFLVYNYLPGGNLEKFIQERSTRDWRVLHKIALDI 811 >At1g45249.2 68414.m05192 ABA-responsive element-binding protein 1 (AREB1) identical to ABA-responsive element binding protein 1 (AREB1) [Arabidopsis thaliana] GI:9967417 Length = 416 Score = 26.2 bits (55), Expect = 9.7 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = -1 Query: 336 GFGTNFRFPTNAGVTGGTGISAGDQPTSRRRGVMTTCTVKLCLARDLGASPP 181 G+GT + G+ GG + GDQ + G + + + A +GA P Sbjct: 243 GYGTQMGQLNSPGIRGGGLVGLGDQSLTNNVGFVQGASAAIPGALGVGAVSP 294 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,706,473 Number of Sequences: 28952 Number of extensions: 247050 Number of successful extensions: 726 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 692941200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -