BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0632 (443 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 75 3e-14 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 74 5e-14 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 74 6e-14 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 74 6e-14 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 73 8e-14 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 71 6e-13 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 71 6e-13 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 70 7e-13 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 58 3e-09 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 50 1e-06 12_02_1282 + 27528159-27529148,27529549-27529614 46 2e-05 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 40 9e-04 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 37 0.008 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 34 0.045 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 32 0.24 09_04_0232 - 15882589-15882720,15882799-15882889,15882987-158830... 27 6.8 07_03_0037 + 12709014-12709104,12709407-12709612,12710033-127100... 27 9.0 06_02_0032 + 10775031-10775520,10775661-10776246,10776333-107769... 27 9.0 01_05_0733 - 24707753-24707819,24708906-24709723 27 9.0 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 74.9 bits (176), Expect = 3e-14 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 VWIGGSILASL TFQQMWI K EYDE GPSIVHRKCF Sbjct: 341 VWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 442 TMKIKIIVLPERKYS 398 +MKIK++ PERKYS Sbjct: 326 SMKIKVVAPPERKYS 340 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 74.1 bits (174), Expect = 5e-14 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 VWIGGSILASL TFQQMWI K EYDE GPSIVHRKCF Sbjct: 338 VWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 374 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 442 TMKIKIIVLPERKYS 398 +MKIK++ PERKYS Sbjct: 323 SMKIKVVAPPERKYS 337 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 73.7 bits (173), Expect = 6e-14 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 VWIGGSILASL TFQQMWI K EYDE GP+IVHRKCF Sbjct: 341 VWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 442 TMKIKIIVLPERKYS 398 +MKIK++ PERKYS Sbjct: 326 SMKIKVVAPPERKYS 340 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 73.7 bits (173), Expect = 6e-14 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 VWIGGSILASL TFQQMWI K EYDE GP+IVHRKCF Sbjct: 341 VWIGGSILASLSTFQQMWISKDEYDESGPAIVHRKCF 377 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 442 TMKIKIIVLPERKYS 398 +MKIK++ PERKYS Sbjct: 326 SMKIKVVAPPERKYS 340 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 73.3 bits (172), Expect = 8e-14 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 VWIGGSILASL TFQQMWI K EYDE GP+IVHRKCF Sbjct: 344 VWIGGSILASLSTFQQMWISKAEYDESGPAIVHRKCF 380 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 442 TMKIKIIVLPERKYS 398 +MKIK++ PERKYS Sbjct: 329 SMKIKVVAPPERKYS 343 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 70.5 bits (165), Expect = 6e-13 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 VWIGGSILASL TFQQMWI + EY+E GP+IVHRKCF Sbjct: 341 VWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKCF 377 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 442 TMKIKIIVLPERKYS 398 +MKIK++ PERKYS Sbjct: 326 SMKIKVVAPPERKYS 340 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 70.5 bits (165), Expect = 6e-13 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 VWIGGSILASL TFQQMWI K EYDE GP IVH KCF Sbjct: 340 VWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 442 TMKIKIIVLPERKYS 398 +MKIK++ PERKYS Sbjct: 325 SMKIKVVAPPERKYS 339 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 70.1 bits (164), Expect = 7e-13 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 VWIGGSILASL TFQQMWI K EYDE GP IVH KCF Sbjct: 340 VWIGGSILASLSTFQQMWISKGEYDESGPGIVHMKCF 376 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 442 TMKIKIIVLPERKYS 398 +MK+K+I PERKYS Sbjct: 325 SMKVKVIAPPERKYS 339 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 58.0 bits (134), Expect = 3e-09 Identities = 32/51 (62%), Positives = 33/51 (64%), Gaps = 14/51 (27%) Frame = -3 Query: 396 VWIGGSILASLFTFQQ--------------MWILKQEYDEFGPSIVHRKCF 286 VWIGGSILASL TFQQ MWI K EYDE GP+IVHRKCF Sbjct: 341 VWIGGSILASLSTFQQVNLTPTLYEVARMQMWISKGEYDESGPAIVHRKCF 391 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 442 TMKIKIIVLPERKYS 398 +MKIK++ PERKYS Sbjct: 326 SMKIKVVAPPERKYS 340 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 49.6 bits (113), Expect = 1e-06 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = -3 Query: 393 WIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 W+GG+ILA + Q + K +YDE GPSIVH+KCF Sbjct: 363 WLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 45.6 bits (103), Expect = 2e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 351 QMWILKQEYDEFGPSIVHRKCF 286 +MWI K EYDE GPSIVHRKCF Sbjct: 330 KMWIAKAEYDESGPSIVHRKCF 351 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 39.9 bits (89), Expect = 9e-04 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQE 328 VWIGGSILASL +FQQMW K + Sbjct: 447 VWIGGSILASLGSFQQMWFSKAD 469 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 36.7 bits (81), Expect = 0.008 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -3 Query: 396 VWIGGSILASLFTFQQMWILKQEYDEFGPSI 304 VW GGS+LAS F + K EY+E+G SI Sbjct: 432 VWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 34.3 bits (75), Expect = 0.045 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -3 Query: 393 WIGGSILASLFTFQQMWILKQEYDEFGPSIVHRKCF 286 W GGS+LA F+ M I K EY+E G R+ F Sbjct: 393 WRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRRFF 428 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 31.9 bits (69), Expect = 0.24 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 405 SILVWIGGSILASLFTFQQMWILKQEYDEFGPSI 304 S W GGS+ AS F + K+EY+E G SI Sbjct: 396 SYAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >09_04_0232 - 15882589-15882720,15882799-15882889,15882987-15883087, 15883494-15883592,15883693-15883830,15883918-15884508, 15884819-15884989,15885068-15885203,15885561-15885592, 15886280-15886336,15886434-15886686,15886762-15886850, 15887181-15887234,15887498-15887689,15887777-15887938 Length = 765 Score = 27.1 bits (57), Expect = 6.8 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 5/37 (13%) Frame = +3 Query: 261 EAATRGAFKNTSCVQWKGQT-----HHTPVSRSTSVG 356 E +RG F + + WKGQ +HT +R T VG Sbjct: 625 EVVSRGGFYVGNGINWKGQVFSKMRNHTVTNRMTGVG 661 >07_03_0037 + 12709014-12709104,12709407-12709612,12710033-12710097, 12710143-12710404,12711332-12711448,12711779-12712056, 12712304-12712406 Length = 373 Score = 26.6 bits (56), Expect = 9.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 387 GGSILASLFTFQQMWILKQEYDEFGPSIV 301 GG++L LFT Q+ L E D PS++ Sbjct: 290 GGAVLRQLFTDDQLVALSHEIDPSVPSLL 318 >06_02_0032 + 10775031-10775520,10775661-10776246,10776333-10776973, 10777270-10777973 Length = 806 Score = 26.6 bits (56), Expect = 9.0 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 262 RQRHAVRLKTLPVYNGRA----KLIILLFQDPHLLEGKKGGEDRS 384 R+ HA+RLK V+N A LII+L D L+ +D+S Sbjct: 244 REHHAIRLKAFFVFNAAAFVMSLLIIMLLLDKQLVIPLLQDQDQS 288 >01_05_0733 - 24707753-24707819,24708906-24709723 Length = 294 Score = 26.6 bits (56), Expect = 9.0 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 329 SMMSLALPLYTGSVFKRTACRCLQQPRPV 243 +++ L LYT + TAC C P PV Sbjct: 144 NLLCLTTLLYTPELATTTACECRDLPEPV 172 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,323,527 Number of Sequences: 37544 Number of extensions: 218993 Number of successful extensions: 490 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 847740284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -