BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0630 (483 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1083 - 23840789-23841634,23841991-23842017,23844401-238444... 34 0.069 08_02_0707 - 20212190-20214592 30 1.1 12_02_0498 + 19721038-19721178,19721376-19721472,19721576-197216... 29 1.5 09_02_0036 + 3217163-3217584,3217752-3218322 29 1.5 12_01_0426 - 3356350-3356745,3357604-3357921 29 2.0 06_03_1321 + 29308538-29308588,29308728-29308827,29308939-293091... 29 2.6 01_06_1556 - 38222071-38222708,38222795-38222822,38222950-382230... 29 2.6 10_08_0500 - 18357828-18358649 28 3.4 08_02_1543 + 27783063-27783182,27784321-27784485,27784577-277846... 28 3.4 08_01_0327 - 2942640-2943456,2944386-2944515,2944679-2944811 28 3.4 11_01_0404 + 3071412-3071464,3073572-3074970 28 4.5 09_06_0005 - 20135073-20135249,20136047-20136824,20137794-201378... 28 4.5 07_03_1629 - 28246440-28247339 27 6.0 07_03_0948 - 22821069-22822067 27 6.0 06_03_0775 - 24510624-24510655,24511228-24512179 27 7.9 03_06_0448 - 34005581-34005655,34005735-34005830,34006669-340076... 27 7.9 03_05_0488 - 24847076-24847220,24847823-24847872,24848139-248482... 27 7.9 03_05_0301 + 22928864-22929787 27 7.9 03_02_0982 + 12925861-12926211,12926309-12926378,12927190-129272... 27 7.9 >07_03_1083 - 23840789-23841634,23841991-23842017,23844401-23844442, 23844882-23845002,23845824-23846062 Length = 424 Score = 33.9 bits (74), Expect = 0.069 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +1 Query: 1 VRYNSNLATKMKYHIFLGLIAAVTAFPGIIHDEAPQVEAKYDHQSLIGESGHHH 162 V YN N TK+ +H+F+ L+ P +A VE + H S++ GHHH Sbjct: 157 VCYNVN-CTKLSHHLFMHLVQN-PRLPLRFVVQAMLVEQLHSHHSMLLSGGHHH 208 >08_02_0707 - 20212190-20214592 Length = 800 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 91 HDEAPQVEAKYDHQSLIGESGHHHQIEHEHAKSHQSIKFEHFH 219 H+ + K +H G HHH H+H++ HQ +H H Sbjct: 565 HNSLTENSCKENHSHCHGHDHHHHH-HHDHSEHHQQ-SGDHAH 605 >12_02_0498 + 19721038-19721178,19721376-19721472,19721576-19721619, 19722120-19722203,19722441-19722662 Length = 195 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 118 KYDHQSLIGESGHHHQIEHEHAKSHQS 198 K+ H LI E G+ Q+E++H K+ QS Sbjct: 159 KHHHIQLIKEKGNFSQLENDHEKASQS 185 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 392 ITIHWPSFYNIM-TGKTLTLPNLITLQH 472 I+ W F N++ +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >12_01_0426 - 3356350-3356745,3357604-3357921 Length = 237 Score = 29.1 bits (62), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 382 NESYYNSLAVILQHHDWKN 438 +ESYY V +QH DW N Sbjct: 203 SESYYFKFGVYMQHRDWSN 221 >06_03_1321 + 29308538-29308588,29308728-29308827,29308939-29309156, 29309251-29310591 Length = 569 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 278 LFKRMLEKWLCSFFTYTGTGWKCSNLID 195 +F RML W C F YTGT S ++ Sbjct: 338 IFVRMLPLWACITFFYTGTAQVNSTFVE 365 >01_06_1556 - 38222071-38222708,38222795-38222822,38222950-38223070, 38223206-38223318,38223424-38223506,38223868-38223930, 38224100-38224254,38224411-38224580,38225101-38225189, 38225304-38225496,38225655-38225779,38226069-38226475, 38226855-38226919,38227414-38227692,38227772-38227845, 38228241-38228292,38228366-38228473,38228871-38228972, 38229100-38229173,38229262-38229435,38229667-38229771, 38229867-38229977,38230364-38230487 Length = 1150 Score = 28.7 bits (61), Expect = 2.6 Identities = 20/70 (28%), Positives = 33/70 (47%) Frame = -2 Query: 221 GWKCSNLIDW*DLACSCSI**WCPDSPIKDWWSYFASTWGASSCIIPGKAVTAAMSPRKI 42 G CS LI + CS S +C D P+++ + +W S+ P VT ++ +KI Sbjct: 310 GIACSFLIKCKNSTCSRSFHTFCLDPPLQEIIGTWECSWCKSNA-APAVKVTEVLTSKKI 368 Query: 41 WYFILVARLL 12 + R+L Sbjct: 369 QRLVGHRRIL 378 >10_08_0500 - 18357828-18358649 Length = 273 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = -3 Query: 358 PPLRTSPPPCLCSVSG*ISLRFCSDFPFSRGCLRSGCAPSSRTQERGGSVR 206 PPL PPP C G + +FC +SR R C R GG++R Sbjct: 96 PPL-PRPPPRQCPRCGSANTKFCYYNNYSRTQPRYLCKACRRHWTEGGTLR 145 >08_02_1543 + 27783063-27783182,27784321-27784485,27784577-27784686, 27784771-27784876,27784952-27785050,27785450-27786607 Length = 585 Score = 28.3 bits (60), Expect = 3.4 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 4/77 (5%) Frame = +1 Query: 85 IIHDEAPQVE--AKYDHQSLIGESGHHHQIEHEHAKSHQSIKFEHFHPVPV--YVKKEHS 252 +I D P V A+ D ++ + G+H ++ ++A S F H H + + Y K E+S Sbjct: 132 MILDNLPLVVPIARPDRDDVVFQGGYHVGVKGQYAGSKDEKYFIHNHLIFLVKYHKDENS 191 Query: 253 HFSSILLKRENQSKTSS 303 S I+ E+ K +S Sbjct: 192 DLSRIVGFEESDIKWAS 208 >08_01_0327 - 2942640-2943456,2944386-2944515,2944679-2944811 Length = 359 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 106 QVEAKYDHQSLIGESGHHHQIEHEHAKSHQ 195 ++E + + Q +G H H EHEH ++HQ Sbjct: 290 EIELEEEEQRQLGHHHHQHHHEHEH-ENHQ 318 >11_01_0404 + 3071412-3071464,3073572-3074970 Length = 483 Score = 27.9 bits (59), Expect = 4.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 142 GESGHHHQIEHEHAKSHQSIKFEH 213 G+ HHH H+K+H S + EH Sbjct: 118 GKIAHHHHHHRHHSKNHGSDEEEH 141 >09_06_0005 - 20135073-20135249,20136047-20136824,20137794-20137854, 20138253-20138523 Length = 428 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 316 RLNTSTAVDLSSRGGP-VPNSP-YNESYYNSLAVILQHHDWKNP 441 RL S++V+ GP + N+ Y +N +++L+H WK+P Sbjct: 192 RLQFSSSVNFVQYRGPELFNAEFYQNDMFNIASILLEHFRWKHP 235 >07_03_1629 - 28246440-28247339 Length = 299 Score = 27.5 bits (58), Expect = 6.0 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 139 IGESGHHHQIEHEH----AKSHQSIKFEHFHPVPVYVKKEHSHFSSILL 273 IG GHHH H H A S+ PV V V S SS LL Sbjct: 137 IGSYGHHHHHHHHHGHGAASGASSVGECSTMPVMVPVDPHRSSMSSSLL 185 >07_03_0948 - 22821069-22822067 Length = 332 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -3 Query: 298 RFCSDFPFSRGCLRSGCAPSSRTQERGGS 212 R C P G +R GC P Q GG+ Sbjct: 296 RLCGPLPRLHGVIRHGCKPYEHNQCAGGA 324 >06_03_0775 - 24510624-24510655,24511228-24512179 Length = 327 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -3 Query: 406 PVNCNMTHYRVNWVPGPPLRTSPPPCLCSVSG*ISLRFCSD 284 P + HY V +PG P + PPP + FC D Sbjct: 163 PAAASPPHYEVFLIPGLPEKPPPPPPKQKAKAITAPPFCLD 203 >03_06_0448 - 34005581-34005655,34005735-34005830,34006669-34007616, 34007684-34007851,34007908-34008099,34008164-34008346, 34008414-34008590,34008667-34012074 Length = 1748 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = +3 Query: 171 ARTRQISPVDQVRTLPPRSCVREEGAQPLLKHPLEKGKSEQNLKLIHPET 320 + + Q +P + RT+PP REE + +++ +E +N ++ ET Sbjct: 1455 SESNQTAPKESERTIPPEHEDREEEKEENMENKIEISIGRENDEVSEQET 1504 >03_05_0488 - 24847076-24847220,24847823-24847872,24848139-24848278, 24848358-24848493,24848584-24848683,24848837-24848949, 24849034-24849132,24849227-24849311,24849799-24850037, 24850202-24850372,24850544-24850784,24850899-24851172, 24851481-24851660,24852170-24852251,24852336-24852437, 24853315-24853384,24853725-24853824,24853931-24854025, 24854105-24854184,24854361-24854439,24854603-24854663, 24855570-24855984 Length = 1018 Score = 27.1 bits (57), Expect = 7.9 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 117 RFDLGSFIMYYSRKSSHCGNESQEDMVLHLGR*ITVVP 4 RF G I +S +++CG + +L LGR + VVP Sbjct: 891 RFAQGHLITLFSA-TNYCGTANNAGAILVLGRDLVVVP 927 >03_05_0301 + 22928864-22929787 Length = 307 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = +1 Query: 73 AFPGIIHDEAPQVEAKYDHQSLIGESGHHHQIEHEH 180 A P + PQ + + H + + HHH H H Sbjct: 257 ALPYHMEPSPPQPSSGHSHDEVSQQQHHHHHHRHHH 292 >03_02_0982 + 12925861-12926211,12926309-12926378,12927190-12927287, 12927467-12927615,12928083-12928198,12928521-12928617, 12929122-12929206,12929303-12929365,12929505-12929645 Length = 389 Score = 27.1 bits (57), Expect = 7.9 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +1 Query: 37 YHIFLGLIAAVTAFPGIIHDEAPQVEAKYDHQSLIGESGHHHQIEHEH 180 +H F L +++ P II + + A + H G SGHHH I+ EH Sbjct: 166 WHAFDVLQGVMSSAPDIIGNVS---HAHHSH----GSSGHHHGIDLEH 206 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,764,124 Number of Sequences: 37544 Number of extensions: 332621 Number of successful extensions: 1131 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1123 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 987904180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -