BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0628 (450 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 1.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 2.3 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 4.0 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 4.0 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 7.1 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.6 bits (46), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 Query: 356 STDPYGVLPLWRSNDLN 406 + DPYG++ W ++ LN Sbjct: 141 AVDPYGLVAQWATDALN 157 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 2.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 336 LPSNRCGSRNRSTTSLAPPLYTG 268 LP++RC SR S + + P +G Sbjct: 79 LPNSRCNSRESSDSLVQPRCPSG 101 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.4 bits (43), Expect = 4.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 225 AGCWRQRRAVV*KHFLCTMEGP 290 A CW Q +AV+ + L + P Sbjct: 391 ASCWAQFKAVLWRSILAVFKEP 412 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.4 bits (43), Expect = 4.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 225 AGCWRQRRAVV*KHFLCTMEGP 290 A CW Q +AV+ + L + P Sbjct: 391 ASCWAQFKAVLWRSILAVFKEP 412 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 20.6 bits (41), Expect = 7.1 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = -2 Query: 359 WIDPRLPLYLPTDVDLETGVRRVWPLHCTQEVLLNHRASLPPAAR 225 W P P+Y ++ CT+ L N+RAS P R Sbjct: 235 WFLPHQPIYPAVTATVQLST-------CTRTTLKNNRASPYPMQR 272 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,301 Number of Sequences: 336 Number of extensions: 1876 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -