BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0628 (450 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 125 1e-29 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 125 2e-29 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 125 2e-29 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 124 3e-29 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 124 3e-29 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 122 1e-28 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 122 2e-28 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 120 5e-28 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 109 1e-24 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 57 8e-09 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 55 2e-08 12_02_1282 + 27528159-27529148,27529549-27529614 50 1e-06 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 50 1e-06 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 47 8e-06 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 44 7e-05 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 39 0.002 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 33 0.080 08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981... 31 0.57 04_01_0554 - 7139623-7140390 29 2.3 12_02_1197 + 26915933-26916298 28 4.0 08_01_0178 - 1509100-1511214 27 7.0 07_03_0463 - 18449908-18450171,18450718-18450810,18451170-184512... 27 7.0 03_05_1049 - 29956379-29956400,29957103-29957188,29957269-299574... 27 9.2 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 125 bits (302), Expect = 1e-29 Identities = 57/63 (90%), Positives = 60/63 (95%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 M KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHR Sbjct: 312 MSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHR 371 Query: 268 KCF 260 KCF Sbjct: 372 KCF 374 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 125 bits (301), Expect = 2e-29 Identities = 56/63 (88%), Positives = 60/63 (95%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 M KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHR Sbjct: 315 MSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHR 374 Query: 268 KCF 260 KCF Sbjct: 375 KCF 377 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 125 bits (301), Expect = 2e-29 Identities = 56/63 (88%), Positives = 60/63 (95%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 M KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHR Sbjct: 315 MSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIVHR 374 Query: 268 KCF 260 KCF Sbjct: 375 KCF 377 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 124 bits (300), Expect = 3e-29 Identities = 56/63 (88%), Positives = 60/63 (95%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 M KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP+IVHR Sbjct: 318 MSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPAIVHR 377 Query: 268 KCF 260 KCF Sbjct: 378 KCF 380 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 124 bits (300), Expect = 3e-29 Identities = 56/63 (88%), Positives = 60/63 (95%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 M KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHR Sbjct: 315 MSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHR 374 Query: 268 KCF 260 KCF Sbjct: 375 KCF 377 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 122 bits (294), Expect = 1e-28 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 M KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVH Sbjct: 314 MSKEITALAPGSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHM 373 Query: 268 KCF 260 KCF Sbjct: 374 KCF 376 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 122 bits (293), Expect = 2e-28 Identities = 54/63 (85%), Positives = 60/63 (95%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 M KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWIS+ EY+ESGP+IVHR Sbjct: 315 MSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHR 374 Query: 268 KCF 260 KCF Sbjct: 375 KCF 377 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 120 bits (289), Expect = 5e-28 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 M KEIT+LAP +MK+K+IAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVH Sbjct: 314 MSKEITSLAPSSMKVKVIAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPGIVHM 373 Query: 268 KCF 260 KCF Sbjct: 374 KCF 376 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 109 bits (262), Expect = 1e-24 Identities = 56/77 (72%), Positives = 60/77 (77%), Gaps = 14/77 (18%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQ--------------QMWIS 311 M KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQ QMWIS Sbjct: 315 MSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQVNLTPTLYEVARMQMWIS 374 Query: 310 KQEYDESGPSIVHRKCF 260 K EYDESGP+IVHRKCF Sbjct: 375 KGEYDESGPAIVHRKCF 391 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 56.8 bits (131), Expect = 8e-09 Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 6/53 (11%) Frame = -3 Query: 400 IIAPPE------RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 260 ++ PPE +YS W+GG+ILA + Q ++K +YDE+GPSIVH+KCF Sbjct: 346 LVKPPEYMPENLARYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 398 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 55.2 bits (127), Expect = 2e-08 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKQE 302 ++KE+ + ++K++A ER++SVWIGGSILASL +FQQMW SK + Sbjct: 418 LEKEVLEESSGNTRVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKAD 469 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 49.6 bits (113), Expect = 1e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -3 Query: 349 LASLSTFQQMWISKQEYDESGPSIVHRKCF 260 LA S +MWI+K EYDESGPSIVHRKCF Sbjct: 322 LAPSSMKIKMWIAKAEYDESGPSIVHRKCF 351 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 49.6 bits (113), Expect = 1e-06 Identities = 24/63 (38%), Positives = 35/63 (55%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 ++KE+ L P ++KIIA + W GGS+LA F+ M I+K EY+E G R Sbjct: 366 LEKELRPLVPDDYQVKIIAQEDPILGAWRGGSLLAHRPDFESMCITKSEYEEMGSMRCRR 425 Query: 268 KCF 260 + F Sbjct: 426 RFF 428 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 46.8 bits (106), Expect = 8e-06 Identities = 18/45 (40%), Positives = 32/45 (71%) Frame = -3 Query: 412 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 278 +++ +++ P ++Y+VW GGS+LAS + F + +K EY+E G SI Sbjct: 418 IEVNVVSHPIQRYAVWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 43.6 bits (98), Expect = 7e-05 Identities = 17/45 (37%), Positives = 29/45 (64%) Frame = -3 Query: 412 MKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 278 +++ ++A P + Y+ W GGS+ AS F + +K+EY+E G SI Sbjct: 385 VEVNVVAHPIQSYAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 39.1 bits (87), Expect = 0.002 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 7/66 (10%) Frame = -3 Query: 448 MQKEITALAPWTMK--IKIIAPPERKYSVWIGGSILASLSTFQQMW-ISKQEYDE----S 290 ++KE+ L P + I++I PP S W G +++++STF + W I K+++ + + Sbjct: 417 LEKELRELLPAHISEGIRVIPPPFGTDSAWFGAKMISNVSTFTEAWCIKKKQFRQKTRRN 476 Query: 289 GPSIVH 272 GPS V+ Sbjct: 477 GPSFVN 482 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 33.5 bits (73), Expect = 0.080 Identities = 15/61 (24%), Positives = 28/61 (45%) Frame = -3 Query: 448 MQKEITALAPWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 269 ++ I P+ +K++ + W G + A+ S F + S +Y E G ++ HR Sbjct: 642 LESGIRQFRPYLSPLKLVRAADPLIDAWRGAAAFAASSKFGRHTFSLADYREHGENLFHR 701 Query: 268 K 266 K Sbjct: 702 K 702 >08_02_0441 - 17196352-17196536,17196780-17196906,17198018-17198101, 17198282-17198348,17198575-17198633,17199211-17199336, 17199406-17199474,17199545-17199653,17199692-17199760, 17199876-17199979,17200518-17200567,17200696-17200774, 17200867-17200938,17201083-17201217,17201311-17201421, 17202088-17202129 Length = 495 Score = 30.7 bits (66), Expect = 0.57 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = -3 Query: 412 MKIKIIAPPERKYSVWIGGSILASL 338 ++++I PP RK+ V++GG++LA + Sbjct: 366 LRLRIEDPPRRKHMVYLGGAVLAGI 390 >04_01_0554 - 7139623-7140390 Length = 255 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -2 Query: 389 SREEVLRMDRWIDPRLPLYLPTDVDLETGVRRVWPLHCTQEVLLNHR 249 S+ +V +++RWI+ + Y P ++++ GV L V+ +HR Sbjct: 91 SQPDVRQIERWINRGVRFYRPVELEITIGVGYDLKLPILGAVVFSHR 137 >12_02_1197 + 26915933-26916298 Length = 121 Score = 27.9 bits (59), Expect = 4.0 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +2 Query: 251 GGLEALPVYNGGARLVVLLFRDPHLLEGREGGEDRSTDPYGVL 379 GG + L V GG R +LL +G D D YG+L Sbjct: 3 GGEDVLVVAPGGGRDALLLVAQESAWRNSDGAGDGDDDDYGML 45 >08_01_0178 - 1509100-1511214 Length = 704 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -3 Query: 424 APWTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 284 A W + + P S + + A TF W+S QEYD+ P Sbjct: 122 ARWRDTVAVPNPSPAPPSTFFPAGVPAPPPTFSPFWVS-QEYDDDEP 167 >07_03_0463 - 18449908-18450171,18450718-18450810,18451170-18451254, 18451607-18451705,18452099-18452238,18453036-18453482 Length = 375 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 159 ITIISYVQLN*RRLQA*IEQPAAGCWR 239 +T + +V L RLQ +E PAA CWR Sbjct: 245 LTFVPFVVL---RLQKFLESPAATCWR 268 >03_05_1049 - 29956379-29956400,29957103-29957188,29957269-29957413, 29958518-29958813,29959242-29959253 Length = 186 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 372 PYGSVDRSSPPSLPSNRCGS 313 P+ V SSPP+LP +CG+ Sbjct: 72 PFVGVPPSSPPALPPIKCGA 91 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,928,912 Number of Sequences: 37544 Number of extensions: 238677 Number of successful extensions: 740 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -