BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0622 (553 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 24 1.2 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 8.3 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 382 PITFRSRQQMILQYPNAKLQRIHHLHHRCQ*QTVYKTETI 501 P F S Q + NAK+ I L+H+ T+Y+ +T+ Sbjct: 65 PEFFDSLWQPDPYFLNAKVSEIAALNHKFSSVTLYRNKTV 104 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +3 Query: 333 IIQCYEDRQPTLPLKKTD 386 + C+E+ P+LPL D Sbjct: 467 VAPCFEEPLPSLPLPGAD 484 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,901 Number of Sequences: 438 Number of extensions: 3320 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -