BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0619 (614 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089259-1|AAL89997.1| 353|Drosophila melanogaster AT04640p pro... 29 6.6 AY052142-1|AAK93566.1| 1367|Drosophila melanogaster SD09926p pro... 28 8.7 AF097636-1|AAF63187.1| 1368|Drosophila melanogaster bicoid-inter... 28 8.7 AE013599-166|AAM68350.1| 1367|Drosophila melanogaster CG8276-PB,... 28 8.7 AE013599-165|AAF57267.2| 1367|Drosophila melanogaster CG8276-PA,... 28 8.7 >AY089259-1|AAL89997.1| 353|Drosophila melanogaster AT04640p protein. Length = 353 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -1 Query: 374 LRTETHYCFAAEICRVVVPTHANSEDVLPPVKVMNEP 264 + T+T A +C VVV H N E V P +EP Sbjct: 314 VETDTRTLVQANLCNVVVIQHLNEEQVEPLSSDASEP 350 >AY052142-1|AAK93566.1| 1367|Drosophila melanogaster SD09926p protein. Length = 1367 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 236 YCRYIRIYITGNAVKSFIVWSN*YHYVMSYQYYEQI 129 +CR I++Y G+ + + WS+ Y+ Y+ Y I Sbjct: 1103 FCRPIQLYAKGDYTPNHVRWSDAYYPQTPYEAYRGI 1138 >AF097636-1|AAF63187.1| 1368|Drosophila melanogaster bicoid-interacting protein BIN3 protein. Length = 1368 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 236 YCRYIRIYITGNAVKSFIVWSN*YHYVMSYQYYEQI 129 +CR I++Y G+ + + WS+ Y+ Y+ Y I Sbjct: 1104 FCRPIQLYAKGDYTPNHVRWSDAYYPQTPYEAYRGI 1139 >AE013599-166|AAM68350.1| 1367|Drosophila melanogaster CG8276-PB, isoform B protein. Length = 1367 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 236 YCRYIRIYITGNAVKSFIVWSN*YHYVMSYQYYEQI 129 +CR I++Y G+ + + WS+ Y+ Y+ Y I Sbjct: 1103 FCRPIQLYAKGDYTPNHVRWSDAYYPQTPYEAYRGI 1138 >AE013599-165|AAF57267.2| 1367|Drosophila melanogaster CG8276-PA, isoform A protein. Length = 1367 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 236 YCRYIRIYITGNAVKSFIVWSN*YHYVMSYQYYEQI 129 +CR I++Y G+ + + WS+ Y+ Y+ Y I Sbjct: 1103 FCRPIQLYAKGDYTPNHVRWSDAYYPQTPYEAYRGI 1138 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,946,363 Number of Sequences: 53049 Number of extensions: 488652 Number of successful extensions: 1105 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1105 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2517878700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -