BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0616 (641 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P53288 Cluster: Putative uncharacterized protein YGR160... 39 0.089 UniRef50_A5G5W4 Cluster: Peptidase S8 and S53, subtilisin, kexin... 36 1.1 >UniRef50_P53288 Cluster: Putative uncharacterized protein YGR160W; n=1; Saccharomyces cerevisiae|Rep: Putative uncharacterized protein YGR160W - Saccharomyces cerevisiae (Baker's yeast) Length = 203 Score = 39.1 bits (87), Expect = 0.089 Identities = 21/81 (25%), Positives = 44/81 (54%) Frame = +1 Query: 280 NNSSNSNWTNIGHDVFPAVIYA*NTINTHICFYITNCSGIAFMTFSDLQFRIVECRHEVS 459 +NS ++ ++I HD P I A +++++ CF + + S + SDL+F ++ +S Sbjct: 7 SNSFFNHSSSIDHDSLPTKIVAGSSVSSFFCFLLEDSSSSSSSASSDLRFLSLDSSFSLS 66 Query: 460 IAW*HDSLQLELRAASQTSYL 522 ++ D + EL + +S+L Sbjct: 67 LSEDEDEDESELEDSFDSSFL 87 >UniRef50_A5G5W4 Cluster: Peptidase S8 and S53, subtilisin, kexin, sedolisin precursor; n=1; Geobacter uraniumreducens Rf4|Rep: Peptidase S8 and S53, subtilisin, kexin, sedolisin precursor - Geobacter uraniumreducens Rf4 Length = 726 Score = 35.5 bits (78), Expect = 1.1 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 160 INNITQAYFISGCERINSGYTNFVVGPTSLQIVVIVRAIRN-NSSNSNWT 306 INN+ A +S N GYTN + P + V V A+ + N + NWT Sbjct: 308 INNLKSAGVVSAISSGNDGYTNAISSPACIPAAVSVGAVYDANVGSRNWT 357 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,391,029 Number of Sequences: 1657284 Number of extensions: 11407606 Number of successful extensions: 22142 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22134 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48126133708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -