BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0616 (641 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0274 - 19636163-19636280,19636359-19636423,19636485-196366... 28 7.2 01_01_1209 - 9738501-9738516,9738703-9739161,9739389-9739608,973... 28 7.2 >05_04_0274 - 19636163-19636280,19636359-19636423,19636485-19636637, 19636738-19637043,19637137-19637314,19637452-19637687, 19637835-19638032,19638171-19638293,19638729-19639013, 19639186-19639326,19639799-19640188,19640465-19640647, 19640934-19641020 Length = 820 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 202 RINSGYTNFVVGPTSLQIVVIVRAIRNNSSNSN 300 R GYT V GP +++ V RA N NS+ Sbjct: 360 RCEDGYTREVSGPEGVRVRVATRAKPNTDKNSS 392 >01_01_1209 - 9738501-9738516,9738703-9739161,9739389-9739608, 9739708-9739831,9739927-9740635,9741826-9742132, 9742213-9743704 Length = 1108 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -1 Query: 515 DVCEAARNSNCKESCYHAIETS*RHSTIRNCRSENVMKAIPE 390 D+ + N+N KESC ++E + H+TI+ R + PE Sbjct: 767 DMTQIVINNNSKESCKRSLEEA--HATIKKLRIASTGTQSPE 806 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,872,980 Number of Sequences: 37544 Number of extensions: 294395 Number of successful extensions: 567 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -