BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0616 (641 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_11465| Best HMM Match : EGF (HMM E-Value=0.13) 28 5.6 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_5247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 158 SYRNNVFDEQTFA*DGNHVNSLVAKAAAMRKDVSR 54 +Y++N F +TF D N VN L KA + DV + Sbjct: 80 AYKSNSFYCETFQMDSNRVNRLFRKAKKLGIDVEK 114 >SB_11465| Best HMM Match : EGF (HMM E-Value=0.13) Length = 695 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -3 Query: 411 CHESNS*TIRNIETYMCIYCVLCVNYCWKHVMSNVSPV*IATIVTYRT 268 CHE + + + E Y CI + VN C + + N+S V +T Y T Sbjct: 168 CHEGATCRLLD-EKYECICPDISVNPCLERIEGNISQVLDSTSALYTT 214 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 220 TNFVVGPTSLQIVVIVRAIRNNSSNSNWTNIG 315 T F+V T L +++RAIR NSN T+ G Sbjct: 44 TGFIVVITYLPTKLLIRAIRRAMVNSNTTSSG 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,304,161 Number of Sequences: 59808 Number of extensions: 380014 Number of successful extensions: 674 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -