BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0616 (641 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC128587-1|AAI28588.1| 410|Homo sapiens ATG9B protein protein. 30 6.1 AY515311-1|AAS87212.1| 924|Homo sapiens sONE protein. 30 6.1 AY316116-1|AAQ86941.1| 363|Homo sapiens SONE protein. 30 6.1 >BC128587-1|AAI28588.1| 410|Homo sapiens ATG9B protein protein. Length = 410 Score = 30.3 bits (65), Expect = 6.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 462 RMVA*LFTVRITGRLTDILSPIMTPMFAGFYF 557 R +A L R L ++LSP++TP+F F+F Sbjct: 100 RQMAQLLQYRAVSLLEELLSPLLTPLFLLFWF 131 >AY515311-1|AAS87212.1| 924|Homo sapiens sONE protein. Length = 924 Score = 30.3 bits (65), Expect = 6.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 462 RMVA*LFTVRITGRLTDILSPIMTPMFAGFYF 557 R +A L R L ++LSP++TP+F F+F Sbjct: 614 RQMAQLLQYRAVSLLEELLSPLLTPLFLLFWF 645 >AY316116-1|AAQ86941.1| 363|Homo sapiens SONE protein. Length = 363 Score = 30.3 bits (65), Expect = 6.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 462 RMVA*LFTVRITGRLTDILSPIMTPMFAGFYF 557 R +A L R L ++LSP++TP+F F+F Sbjct: 53 RQMAQLLQYRAVSLLEELLSPLLTPLFLLFWF 84 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,039,230 Number of Sequences: 237096 Number of extensions: 1644464 Number of successful extensions: 1965 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1965 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7085195460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -