BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0616 (641 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023941-1|ABB36445.1| 766|Drosophila melanogaster RE01666p pro... 29 4.1 BT003547-1|AAO39551.1| 766|Drosophila melanogaster RE01983p pro... 29 4.1 AE014135-53|AAS64605.2| 766|Drosophila melanogaster CG2380-PB p... 29 4.1 >BT023941-1|ABB36445.1| 766|Drosophila melanogaster RE01666p protein. Length = 766 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 229 VVGPTSLQIVVIVRAIRNNSSNSNWTNIGHDVFPAVIYA*NTINTHI 369 V+ PT L + A+ +S+ + W H+V P + N NT + Sbjct: 699 VISPTDLTLYSAPMAVSRSSTRTRWNEEEHNVIPQSASSTNMDNTQV 745 >BT003547-1|AAO39551.1| 766|Drosophila melanogaster RE01983p protein. Length = 766 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 229 VVGPTSLQIVVIVRAIRNNSSNSNWTNIGHDVFPAVIYA*NTINTHI 369 V+ PT L + A+ +S+ + W H+V P + N NT + Sbjct: 699 VISPTDLTLYSAPMAVSRSSTRTRWNEEEHNVIPQSASSTNMDNTQV 745 >AE014135-53|AAS64605.2| 766|Drosophila melanogaster CG2380-PB protein. Length = 766 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 229 VVGPTSLQIVVIVRAIRNNSSNSNWTNIGHDVFPAVIYA*NTINTHI 369 V+ PT L + A+ +S+ + W H+V P + N NT + Sbjct: 699 VISPTDLTLYSAPMAVSRSSTRTRWNEEEHNVIPQSASSTNMDNTQV 745 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,397,592 Number of Sequences: 53049 Number of extensions: 543683 Number of successful extensions: 902 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 900 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2703623850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -